[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63787.1
DDBJ      :             conserved protein with 2 CBS domains
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  291/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->121 2rc3C PDBj 3e-14 37.6 %
:RPS:PDB   1->120 2d4zA PDBj 1e-17 15.0 %
:RPS:SCOP  6->121 2yziA1  d.37.1.1 * 8e-24 32.2 %
:HMM:SCOP  5->67 1zfjA2 d.37.1.1 * 5.9e-10 23.8 %
:HMM:SCOP  64->119 2o16A2 d.37.1.1 * 1.8e-14 42.9 %
:RPS:PFM   12->122 PF00478 * IMPDH 6e-06 27.2 %
:HMM:PFM   3->59 PF00571 * CBS 6.6e-14 23.6 55/57  
:HMM:PFM   68->120 PF00571 * CBS 2.7e-18 35.8 53/57  
:BLT:SWISS 6->119 YBP3_ACIAM 2e-17 39.3 %
:REPEAT 2|6->56|71->119

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63787.1 GT:GENE AAL63787.1 GT:PRODUCT conserved protein with 2 CBS domains GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1107855..1108283 GB:FROM 1107855 GB:TO 1108283 GB:DIRECTION + GB:PRODUCT conserved protein with 2 CBS domains GB:NOTE Unclassified GB:PROTEIN_ID AAL63787.1 GB:DB_XREF GI:18160433 LENGTH 142 SQ:AASEQ MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDNIMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEISAHD GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 6->119|YBP3_ACIAM|2e-17|39.3|112/164| NREPEAT 1 REPEAT 2|6->56|71->119| BL:PDB:NREP 1 BL:PDB:REP 11->121|2rc3C|3e-14|37.6|109/128| RP:PDB:NREP 1 RP:PDB:REP 1->120|2d4zA|1e-17|15.0|120/169| RP:PFM:NREP 1 RP:PFM:REP 12->122|PF00478|6e-06|27.2|103/459|IMPDH| HM:PFM:NREP 2 HM:PFM:REP 3->59|PF00571|6.6e-14|23.6|55/57|CBS| HM:PFM:REP 68->120|PF00571|2.7e-18|35.8|53/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 6->121|2yziA1|8e-24|32.2|115/132|d.37.1.1| HM:SCP:REP 5->67|1zfjA2|5.9e-10|23.8|63/64|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 64->119|2o16A2|1.8e-14|42.9|56/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 597 OP:NHOMOORG 354 OP:PATTERN 3315-27576565639-2C7B9A3-------1--3551221112----1-224111211112113--3 -1--1-------11-11----1--11-----12---1---1121-1--------------221-111311---------------111-------------1---1--1----------------12-11-11122222-1-----312111321--------1---112--------------1-1111--3------111111-111--111-111121----------11-------------------------------------------------------------------------------------------11211111111-1-1---1-----1-----41---1-1211---------3-1112-----112222111221211-11111-11-12111111111-2--11121111222-112111111221--------1----12-------------------------------2---------4223231222233233333-11231211-----1-11111122--22-1-111-------122231----1-1--1--------------1151--------------------------------------1111------11----2--1-11----1----------------------------------------------------------------------------------------------------1-----1-1---------------1111111-----21321121311121111----------111-111112111111-1-11-------------1111-----------------------------------------1-111--- ----11--------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------4313-22--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 100.0 SQ:SECSTR ccTTcccccccccEETTccHHHHHHHHHHccccEEEEccTTTccEEEEEEHHHHHHHHHHHHHcccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHHHHHHTTHHHHHHHHHHTHcccc DISOP:02AL 139-142| PSIPRED cEEEcccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccc //