[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63800.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   48->127 PF05425 * CopD 2.2e-06 26.6 79/105  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63800.1 GT:GENE AAL63800.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1118721..1119116 GB:FROM 1118721 GB:TO 1119116 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63800.1 GB:DB_XREF GI:18160447 LENGTH 131 SQ:AASEQ MLYEILLSIHLLSLVGWAGLSTGAYLVVREVAGSVLPNSYKRLVHAQAAFAGLLFLSGLTMAVLVYGFPKSPLWIHYALGVALVAGAIEAYHVRAARRYSAERYHRAIRMLAPAWAVILAVMLWLMVWKPF GT:EXON 1|1-131:0| TM:NTM 4 TM:REGION 10->32| TM:REGION 46->68| TM:REGION 73->95| TM:REGION 107->129| SEG 46->59|aqaafagllflsgl| HM:PFM:NREP 1 HM:PFM:REP 48->127|PF05425|2.2e-06|26.6|79/105|CopD| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------1----------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-53,59-59,62-62,67-67| PSIPRED cHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //