[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63810.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:150 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->148 1pv7A_ f.38.1.2 * 2.2e-08 21.4 %
:HMM:PFM   19->149 PF07690 * MFS_1 1.2e-09 20.0 130/353  
:BLT:SWISS 1->139 ITR2_SCHPO 5e-05 30.4 %
:PROS 58->74|PS00216|SUGAR_TRANSPORT_1
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63810.1 GT:GENE AAL63810.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1123808..1124260 GB:FROM 1123808 GB:TO 1124260 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63810.1 GB:DB_XREF GI:18160458 LENGTH 150 SQ:AASEQ MWIKRNIAMLYGVGYSKGFINGFLSWYLSLRLYDWGLAVFAAVRLVAQVLDSLANLAGGYLADKIGRKPTLIITDVIYVSSILCLLRSELLPLAVLLFYVADGLPTSASFVMRIESVPENWRGKIISIGPALSYASYAAGSFALGFIAAS GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->139|ITR2_SCHPO|5e-05|30.4|135/557| PROS 58->74|PS00216|SUGAR_TRANSPORT_1|PDOC00190| TM:NTM 3 TM:REGION 35->57| TM:REGION 72->94| TM:REGION 124->146| HM:PFM:NREP 1 HM:PFM:REP 19->149|PF07690|1.2e-09|20.0|130/353|MFS_1| HM:SCP:REP 4->148|1pv7A_|2.2e-08|21.4|145/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHccc //