[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63818.1
DDBJ      :             phoH like protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  776/915 : Eukaryota  2/199 : Viruses  5/175   --->[See Alignment]
c.37.1d.51.1d.52.3
:371 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->199 3b85A PDBj 3e-14 34.1 %
:BLT:PDB   256->297 2opvA PDBj 4e-04 33.3 %
:RPS:PDB   1->160 3e1sA PDBj 1e-04 19.7 %
:RPS:PDB   263->346 2cxcA PDBj 4e-04 31.3 %
:RPS:SCOP  24->47 1e6cA  c.37.1.2 * 9e-05 16.7 %
:RPS:SCOP  246->293 1hh2P3  d.52.3.1 * 2e-04 22.9 %
:RPS:SCOP  264->313 1x4mA1  d.51.1.1 * 3e-04 22.0 %
:HMM:SCOP  5->160 1w36D1 c.37.1.19 * 8.3e-16 23.7 %
:HMM:SCOP  235->299 1k0rA3 d.52.3.1 * 7.2e-07 30.8 %
:RPS:PFM   5->199 PF02562 * PhoH 9e-27 38.6 %
:HMM:PFM   4->209 PF02562 * PhoH 4.3e-52 34.7 202/205  
:HMM:PFM   262->330 PF07650 * KH_2 3.5e-15 33.3 57/59  
:BLT:SWISS 5->199 PHOL_BACSU 9e-24 32.8 %
:BLT:SWISS 256->309 NUSA_METVS 8e-07 42.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63818.1 GT:GENE AAL63818.1 GT:PRODUCT phoH like protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1129833..1130948 GB:FROM 1129833 GB:TO 1130948 GB:DIRECTION + GB:PRODUCT phoH like protein GB:NOTE Regulatory functions; General GB:PROTEIN_ID AAL63818.1 GB:DB_XREF GI:18160467 LENGTH 371 SQ:AASEQ MFDKIKPMTVGQERAVNVLKDPDNELVGLFGPTGTGKSLISIAYGLWAVENGRAKRFIIARPIVDVATGEILTPEKLGEMYYKIASAYLEDILGPYADREYINKLLKEEKVIVTDVSYLRGRTFDESVIFLDDAQNVRPESAAEILIRLGRGSRLIVAGDPIFQKPADSEKDGATLLREALLGEEKAEVVDLGVKDIVRPGARRGIKLALELRMRKRQLSETEKYIYETARIFAPDADIITAIEFKADKDSLGIRGENVPDAIVVVKEGQLGRVVGRGGERIKMIEGEAGARLRLLEMSLDFKQWVRAIHPVGWIYKHIVDADFAGPELQVQVRKSEFGAFIGQRGAYVRLVDRVFRRLLGIGVRAVEAEE GT:EXON 1|1-371:0| BL:SWS:NREP 2 BL:SWS:REP 5->199|PHOL_BACSU|9e-24|32.8|189/319| BL:SWS:REP 256->309|NUSA_METVS|8e-07|42.6|54/173| SEG 349->360|vrlvdrvfrrll| BL:PDB:NREP 2 BL:PDB:REP 5->199|3b85A|3e-14|34.1|167/180| BL:PDB:REP 256->297|2opvA|4e-04|33.3|42/85| RP:PDB:NREP 2 RP:PDB:REP 1->160|3e1sA|1e-04|19.7|132/517| RP:PDB:REP 263->346|2cxcA|4e-04|31.3|83/138| RP:PFM:NREP 1 RP:PFM:REP 5->199|PF02562|9e-27|38.6|189/205|PhoH| HM:PFM:NREP 2 HM:PFM:REP 4->209|PF02562|4.3e-52|34.7|202/205|PhoH| HM:PFM:REP 262->330|PF07650|3.5e-15|33.3|57/59|KH_2| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02562|IPR003714| RP:SCP:NREP 3 RP:SCP:REP 24->47|1e6cA|9e-05|16.7|24/170|c.37.1.2| RP:SCP:REP 246->293|1hh2P3|2e-04|22.9|48/68|d.52.3.1| RP:SCP:REP 264->313|1x4mA1|3e-04|22.0|50/81|d.51.1.1| HM:SCP:REP 5->160|1w36D1|8.3e-16|23.7|139/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 235->299|1k0rA3|7.2e-07|30.8|65/67|d.52.3.1|1/2|Prokaryotic type KH domain (KH-domain type II)| OP:NHOMO 1028 OP:NHOMOORG 799 OP:PATTERN 111111-------1-11111111------------------------------1-------------- 1111221222221122222-22222222222122222222222222222112222111--1122122222211111111-111111111111-1221--1111111211211111111111111111111111111----------2111111112221211111111111111121112112111111121111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111--1111111-1-111111111-21111121221111211111211--111222211111111111111111111111111111-11211211111-1111111111111122311111111111111111111111222-----------------------------111111111111111111111111111111111111111--11111111111211111111111111111111111112221111121112-11111112122222111-------------------------11221221222211222221222222222222--111--------22221222222222212-2222222222222222222222222222222112111232222222121121-22222211222211-211111222212222111111-----11111111111111222222222222222222211111111111112111112111111111111111111--11111111--------1-1-------------------------121222222211- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----------------------- -------------------1---11------------------------------------------1--------------------------------------------------------------------------------------------1-------------- STR:NPRED 278 STR:RPRED 74.9 SQ:SECSTR cTTTTTTccHHHHHHHHHHTTTcccEEEEEccTTccHHHHHHHHHHHHHHTTcEccEEEEEccHHHHHTTcHHHHHHTccEEEHHHHTTEETTEEccccccccccccccHEEEHHHHHHHHHHHHHcEEEEccGGGccHHHHHHHHTTccTTcEEEEEEc###########cccHHHHHHTTTcTTEEEEEccGGGccc########################################################ccccEEEEEEEcTTcHHHHHcGGGHHHHHHHHHHccEEEEEEccccHHHHHHHcTTcc#EEEEEEEEETTEEEEEEEEcTTTHHHHHcGGG######################### DISOP:02AL 213-229, 368-371| PSIPRED cccccccccHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEccHHHccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccEEEEEccccccccccccEEEEEccccccHHHHHHHHHHcccccEEEEEccEEEccccccccccHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEHHHHHHccccccccccEEEEEEcccccHHHHccHHHHHHHHHHHccEEEEEEHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEcHHHccccccccccHHHHHHHHHHHHHcccEEEEEccc //