[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63820.1
DDBJ      :             UDP-glucose 4-epimerase (galE-1)
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  823/915 : Eukaryota  189/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:314 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->310 3eheA PDBj 3e-73 52.4 %
:RPS:PDB   2->305 1db3A PDBj 4e-37 21.8 %
:RPS:SCOP  2->304 1sb8A  c.2.1.2 * 3e-55 25.4 %
:HMM:SCOP  1->314 2c5aA1 c.2.1.2 * 4e-78 38.5 %
:RPS:PFM   3->216 PF01370 * Epimerase 3e-36 41.7 %
:HMM:PFM   3->221 PF01370 * Epimerase 1.9e-54 42.9 217/238  
:BLT:SWISS 3->301 GALE_METJA 1e-44 36.8 %
:PROS 124->152|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63820.1 GT:GENE AAL63820.1 GT:PRODUCT UDP-glucose 4-epimerase (galE-1) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1132026..1132970) GB:FROM 1132026 GB:TO 1132970 GB:DIRECTION - GB:PRODUCT UDP-glucose 4-epimerase (galE-1) GB:NOTE Cell envelope; Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides GB:PROTEIN_ID AAL63820.1 GB:DB_XREF GI:18160469 LENGTH 314 SQ:AASEQ MRIVVTGGAGFIGSHLVDRLVEEGHEVVVVDNLSSGRREFVNKAAELYIRDLKESDWGVGIRGDVVFHFAANPEVRLSTTEPVVHFNENVLATFNVLEWARQTGVKSVIFASSSTVYGDAEVIPTPEEAPYKPISVYGAAKAAGEVMCATYARLYGVKCLAIRYANIIGPRLRHGVIYDFIMKLKRNPNVLEVLGDGTQRKSYLYIKDAIDATILAWKKFEEIKEPFLALNVGNLDAIKVLDIAQIVAEVLGLRPEIKLVPTTPDGRGWPGDVKYMTLSITKLMKMTGWRPTMTSGEAVRKTAEDLAKELWQTR GT:EXON 1|1-314:0| BL:SWS:NREP 1 BL:SWS:REP 3->301|GALE_METJA|1e-44|36.8|285/305| PROS 124->152|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 3->310|3eheA|3e-73|52.4|286/290| RP:PDB:NREP 1 RP:PDB:REP 2->305|1db3A|4e-37|21.8|293/335| RP:PFM:NREP 1 RP:PFM:REP 3->216|PF01370|3e-36|41.7|211/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 3->221|PF01370|1.9e-54|42.9|217/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 2->304|1sb8A|3e-55|25.4|299/341|c.2.1.2| HM:SCP:REP 1->314|2c5aA1|4e-78|38.5|299/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4966 OP:NHOMOORG 1081 OP:PATTERN 11311-323443354225121343A3337663365327132224746768565143322342343-14 8AC3822544511124477-742236888882365524374A9933111663845212115311756779322222232122846754CA9727221--54748688B96--------------343444775765EFFCE-11B6A87C8893344744565465987B67454465675364231133423544545885447567737664444845233431112117D333323313333333511126111442231334114324213221123223334333442422432411111111111113223332222341856666777664814433425281-53142569767233312122213997577-----65GFA5548869D43534354547-BBAGBHCA5D328886HJEJNGBD73433344A9AA45-3333333353466D96-----------------------------3354313983466655844444779A544432569666435763922332556325538433453322222456695275B64BB796CB87CA9699D6976777F78444414545531312111-12232365446454333152343423222425323123--16534------24464443543333442-5434455534533223323422425453144434333453543534233343-524444434445--3-767772333626542211212132232224222214323524434575333544344423332233351244111112413535333332333323--85559999111111114-1----------1-1---23-1-----1143532332674 -122545-323157643431354544511111111111-11111113222365612223433322-11-2-121211-1112222243-36332513133223567-5D4A665456322225586283KJ7-4864322535432455162254535757A5A631234L35659568*D9956WNXY4YK8997878 -----------------------3--------------------------------------------------------------------------------------------------------------------------------------------------12--- STR:NPRED 314 STR:RPRED 100.0 SQ:SECSTR cEEEEETTTcHHHHHHHHHHHHTTcEEEEEccccEEEcccccccHHHHHHHTTHHHHHHHHcccEEEEcccccTTTTTTccHHHHHHHHTHHHHHHHHHHHHTTcTTEEEEEEGGGGTTcccccccTTcccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEcTTccTHHHHHHHHHHHTTccccEEEccTTcEEccEEHHHHHHHHHHTTcccHHcccccccEEEcccccEEHHHHHHHHHHTTTEEEEEEccGGGcEEGGccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcc DISOP:02AL 314-315| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccHHHcccccEEEEcccccHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHcccccEEEEcccccEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEHHHHHHHHHHHHcccccEEEEccccccccccccccEEcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccc //