[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63822.1
DDBJ      :             3-dehydroquinate synthase
Swiss-Prot:AROB_PYRAE   RecName: Full=3-dehydroquinate synthase;         EC=4.2.3.4;

Homologs  Archaea  27/68 : Bacteria  805/915 : Eukaryota  120/199 : Viruses  0/175   --->[See Alignment]
e.22.1
:345 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   94->283 1dqsB PDBj 9e-37 44.4 %
:RPS:PDB   105->314 1cb2A PDBj 2e-41 14.4 %
:RPS:SCOP  15->320 1dqsA  e.22.1.1 * 4e-44 33.6 %
:HMM:SCOP  2->337 1dqsA_ e.22.1.1 * 2.4e-76 39.1 %
:RPS:PFM   48->304 PF01761 * DHQ_synthase 1e-55 48.6 %
:HMM:PFM   34->305 PF01761 * DHQ_synthase 6.3e-91 48.1 270/313  
:BLT:SWISS 1->345 AROB_PYRAE e-176 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63822.1 GT:GENE AAL63822.1 GT:PRODUCT 3-dehydroquinate synthase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1134174..1135211) GB:FROM 1134174 GB:TO 1135211 GB:DIRECTION - GB:PRODUCT 3-dehydroquinate synthase GB:NOTE Amino acid biosynthesis; Aromatic amino acid family GB:PROTEIN_ID AAL63822.1 GB:DB_XREF GI:18160471 LENGTH 345 SQ:AASEQ MRRFFYTHSRGVTEVVVGRGIPYDKYVERPVVLIEEGLENPLPNAPALALKGGEGVKSLEALSKVYVFLQEAEADRGSTLVAVGGGALLDLATFAAGTYMRGIGLVQVPTTLLAMVDAALGGKGAVDWGLVKNLVGVFYQPKAILCDLEWLRSLPPRVYRSAFAEVVKYGLALDEEFYSWLRQSTTALLNRGEDALEEAVYRSLKLKASVVEADEFEERGIRQVLNVGHTVGHALERVLGLLHGEAVSLGIAAELRLSAELGYLREKYVEETKSLLKAFELPTEAGLSSEQLAAAKGLIKYDKKRRRDYVYLPLVIRPGKWILERLRVEEVARAVEYVVPQGRTA GT:EXON 1|1-345:0| SW:ID AROB_PYRAE SW:DE RecName: Full=3-dehydroquinate synthase; EC=4.2.3.4; SW:GN Name=aroB; OrderedLocusNames=PAE1926; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Cytoplasm; Lyase; NAD. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->345|AROB_PYRAE|e-176|100.0|345/345| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| SEG 80->92|lvavgggalldla| SEG 323->339|lerlrveevaraveyvv| BL:PDB:NREP 1 BL:PDB:REP 94->283|1dqsB|9e-37|44.4|189/380| RP:PDB:NREP 1 RP:PDB:REP 105->314|1cb2A|2e-41|14.4|201/363| RP:PFM:NREP 1 RP:PFM:REP 48->304|PF01761|1e-55|48.6|253/312|DHQ_synthase| HM:PFM:NREP 1 HM:PFM:REP 34->305|PF01761|6.3e-91|48.1|270/313|DHQ_synthase| GO:PFM:NREP 2 GO:PFM GO:0003856|"GO:3-dehydroquinate synthase activity"|PF01761|IPR002658| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01761|IPR002658| RP:SCP:NREP 1 RP:SCP:REP 15->320|1dqsA|4e-44|33.6|304/381|e.22.1.1| HM:SCP:REP 2->337|1dqsA_|2.4e-76|39.1|335/388|e.22.1.1|1/1|Dehydroquinate synthase-like| OP:NHOMO 1066 OP:NHOMOORG 952 OP:PATTERN 11-1--1111111111-111111-------------------------------11-111-111---- 1111111111111111111-111131111111111112111322111111111111111132114121111111111111111-----11111111-111111122121211111111111111121121111111111112222113311111111111111111122421111111211111211111-111111111111111111111111111111111111111111111111111111111111111----------11----1--11-1111111111111111111111111111111111111111111111-11111222222312111111111111-11111111111111111111-11112111111111111112112211111111111111-11111111111-1111111111111111111111111111111111111111211-----------------------------11111111111111111111111111111111111111121111111111112111112111211111111111111-12-1----11----22221111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111211113211111111111111111111111111111111111111111111111111111221111--------1-1---------------------------1--1-111112 ------2-----111322221121111111111111111-111111121122212221111111-111-21211111-111-111111-23121111111132222-12---2------------------------------------------11------1---------1-211161111211312212211114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 88.4 SQ:SECSTR #########cccccEEEEHHHcHHHHHHHHHHHHHHTTTccccEEEEEEEcccGGGccHHHHHHHHHHHHTccccTTcEEEEEEcHHHHHHHHHHHHHGGGccEHTTccccEEccGGGHHHHHHHHHHHHHHHHTTccEEEEEEEcccTTccTTcccHHccccccGGGTHHHHHHHHHHHHHHHHHHTTTccTTcTTHHHHcTTcHHHHHHHHHTHHHHHHHHHHHTTccTTEEEEEEccTTccHHHHHHHHHHHHHHHHHHHTTccTTEEEEEEcTTcccccccccccGGGTccHTcccccHHHHHHHHHHHH############################### DISOP:02AL 343-345| PSIPRED cccEEEEcccccEEEEEccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEccHHHHHHccccccccEEEcccccccEEEEccccEEEEcHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccEEEEEEEccccEEEEEEccHHHHHHHHHHHHcccccc //