[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63827.1
DDBJ      :             conserved protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  130/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->178 3d5nA PDBj 3e-19 35.6 %
:RPS:PDB   2->178 2e8bA PDBj 2e-15 23.0 %
:RPS:SCOP  7->186 1e5kA  c.68.1.8 * 7e-17 17.9 %
:HMM:SCOP  7->186 1vh1A_ c.68.1.13 * 2.7e-17 32.2 %
:HMM:PFM   10->121 PF02348 * CTP_transf_3 7.6e-08 21.8 110/217  
:BLT:SWISS 11->182 YGFJ_ECOLI 1e-12 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63827.1 GT:GENE AAL63827.1 GT:PRODUCT conserved protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1139004..1139570) GB:FROM 1139004 GB:TO 1139570 GB:DIRECTION - GB:PRODUCT conserved protein GB:NOTE Energy metabolism; Other GB:PROTEIN_ID AAL63827.1 GB:DB_XREF GI:18160477 LENGTH 188 SQ:AASEQ MAPLEVKCAGVVLAAGGSARFGSQKLLANFKGRPLVWHAAETLRSAGLETYIVVNSREVASAAGRVDGIIYNPWWRQGLSTSLKAALIALYQKKCIVWMPGDMPCVKPDTVLKIASACKSGLAVPVYRGARGNPVASCRDVYALALGITGDVGLRVLLNAVPTLSLEVEDAGVLADVDFPGDLQRLPC GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 11->182|YGFJ_ECOLI|1e-12|31.3|163/192| BL:PDB:NREP 1 BL:PDB:REP 11->178|3d5nA|3e-19|35.6|163/173| RP:PDB:NREP 1 RP:PDB:REP 2->178|2e8bA|2e-15|23.0|174/185| HM:PFM:NREP 1 HM:PFM:REP 10->121|PF02348|7.6e-08|21.8|110/217|CTP_transf_3| RP:SCP:NREP 1 RP:SCP:REP 7->186|1e5kA|7e-17|17.9|179/188|c.68.1.8| HM:SCP:REP 7->186|1vh1A_|2.7e-17|32.2|177/0|c.68.1.13|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 153 OP:NHOMOORG 148 OP:PATTERN ----1-1111111111--11111-1---1--------------------------------------- ----1--------------------------------1111-------------1-----1------1--------------1------------------------------------------------------111-----1---111-------------------------------------------------------------------1---------------------------------1-----------------------------------------------------------------------1-12211222-1----------1--------11-11--1-1-------------1-----1-11111111111--------------------111-111---11--1--1-1---------1------------111----------------------------------1--111-1--------------1------------1--11-11---111---111-1--------------1----1---1--11-----11-1-----------1-----------------------------------------------------------------------1-----1111111111-111111111111111111--------------------------1-----1------------------------------1--------------------------1-----1-1--11-1--1----------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 98.4 SQ:SECSTR #TTcccccEEEEEEEcccccccTTHHHHHHHHHHHHHHHHHHHHTTccEEEEEEcccGGGGGGTccEEEcccccccHHHHHHHHHHHHHHccccEEEEEETTcTTccHHHHHHHHTccccEEEEEcccEEEEEEEEEGGGHHHHHHHHTTcccHHHHHHccEEEEccGGGGGGGcccccHHHHHTT## DISOP:02AL 1-5| PSIPRED cccccccEEEEEEcccccccccccccEEEEccEEHHHHHHHHHHHccccEEEEEccccHHHHHHHccccEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccEEEEEEccccccccEEcHHHHHHHHHHHccHHHHHHHHHcccEEEEEccccEEEEcccHHHHHcccc //