[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63828.1
DDBJ      :             carbon monoxide dehydrogenase large subunit, conjectural
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  363/915 : Eukaryota  141/199 : Viruses  0/175   --->[See Alignment]
d.133.1d.41.1
:723 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->723 1ffuB PDBj e-103 36.3 %
:RPS:PDB   4->723 3b9jC PDBj e-177 25.4 %
:RPS:SCOP  4->115 1ffuB1  d.41.1.1 * 5e-33 42.0 %
:RPS:SCOP  114->723 1rm6A2  d.133.1.1 * e-153 31.9 %
:HMM:SCOP  1->134 1t3qB1 d.41.1.1 * 8.5e-40 47.8 %
:HMM:SCOP  103->722 1ffvB2 d.133.1.1 * 9.5e-193 44.0 %
:RPS:PFM   18->110 PF01315 * Ald_Xan_dh_C 5e-15 53.8 %
:RPS:PFM   140->655 PF02738 * Ald_Xan_dh_C2 5e-91 45.8 %
:RPS:PFM   647->723 PF04378 * DUF519 3e-04 31.1 %
:HMM:PFM   131->657 PF02738 * Ald_Xan_dh_C2 1.6e-144 38.2 524/543  
:HMM:PFM   18->111 PF01315 * Ald_Xan_dh_C 1.1e-22 47.9 94/111  
:BLT:SWISS 12->723 DCML_HYDPS e-102 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63828.1 GT:GENE AAL63828.1 GT:PRODUCT carbon monoxide dehydrogenase large subunit, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1139552..1141723) GB:FROM 1139552 GB:TO 1141723 GB:DIRECTION - GB:PRODUCT carbon monoxide dehydrogenase large subunit, conjectural GB:NOTE Energy metabolism; Other GB:PROTEIN_ID AAL63828.1 GB:DB_XREF GI:18160478 LENGTH 723 SQ:AASEQ MKYVGRPIPRFEDDVILSGRAQYVDDIVLPGMLYAGFVRSPYAHARVLRVDLSDAAKQKGVVAVFGPEEMGFAPGGKVRYQGEAVAMVVAGDRYLLYDALEKVVVDYEPLPAVLDVFEALRPGAPLVDENLGTNIAHEEVYEGGDVDSAMREAEVKIEERLTIQRVVPAAMEPRGVVAAYDGDMLTIWSSTQVPFDIRKEVAKALDIPLVKVRAVQPFVGGAFGSKLIVYPEEIWVSKAAYLLKRPVKWVATRSEDFKTTTHGRALILDYRVGATRDGRILAIEGTVYADAGAYYWGEGLADTAARMLPGPYDIRNGRVKAVAVLTNKTPLSAYRGAGRPEATFFIERIMDRLADELGIDRVEIRERNLIRQLPYTNVFGITYDTGDYLTTFKQGLERLGYSQLKQWAEEELKRGRVVGVGFSVYVEITTFGYETAILRAERDGTFTLYTALTPHGQGLATALAQIVAEELDVPIESVKVVWGDTALISDGIGTMGSRSITAGGSAAILAARRLKEELLKAARKVLGCDPEYSGGKFSCGGKSATVKDVVRAVYRGEAEAQLTVEAIYHADSTFPFGVHLAVVELDPETGFVKPMLYKSYDDVGVVVNPLLASGQITGGALQGIAQALYEEVVYDESGNLITSNLAFYYVPTAAEAPKYEVYFAESPHRSKHPTGTKGIGEAATIASTPAVIAAVEDAVRRIKPGVRINKTPVTPEFLWRLLR GT:EXON 1|1-723:0| BL:SWS:NREP 1 BL:SWS:REP 12->723|DCML_HYDPS|e-102|36.7|701/803| BL:PDB:NREP 1 BL:PDB:REP 10->723|1ffuB|e-103|36.3|703/795| RP:PDB:NREP 1 RP:PDB:REP 4->723|3b9jC|e-177|25.4|705/758| RP:PFM:NREP 3 RP:PFM:REP 18->110|PF01315|5e-15|53.8|93/110|Ald_Xan_dh_C| RP:PFM:REP 140->655|PF02738|5e-91|45.8|498/519|Ald_Xan_dh_C2| RP:PFM:REP 647->723|PF04378|3e-04|31.1|74/244|DUF519| HM:PFM:NREP 2 HM:PFM:REP 131->657|PF02738|1.6e-144|38.2|524/543|Ald_Xan_dh_C2| HM:PFM:REP 18->111|PF01315|1.1e-22|47.9|94/111|Ald_Xan_dh_C| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01315|IPR000674| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01315|IPR000674| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02738|IPR008274| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02738|IPR008274| RP:SCP:NREP 2 RP:SCP:REP 4->115|1ffuB1|5e-33|42.0|112/140|d.41.1.1| RP:SCP:REP 114->723|1rm6A2|e-153|31.9|596/636|d.133.1.1| HM:SCP:REP 1->134|1t3qB1|8.5e-40|47.8|134/165|d.41.1.1|1/1|CO dehydrogenase molybdoprotein N-domain-like| HM:SCP:REP 103->722|1ffvB2|9.5e-193|44.0|613/0|d.133.1.1|1/1|Molybdenum cofactor-binding domain| OP:NHOMO 1595 OP:NHOMOORG 526 OP:PATTERN 223-1-788888988A--21111-2---1--------------------------------1------ 13824---------1--11-12--5711111433331369231311---11-2121----1-A-14A455--------1---41--1--------------1-216-3----------------------------34433----A-1-111---------------1-2--------------23-------1-----1---------12---1----21-----------1--------------------1----------------------------------------------------------------------64-24444344434-5------31-21-112-312332-3-4-------4--3332------2FGG413576961111-11-111-98C76C9C683-52241183317B5521-871333366811111111A1111321------------------------------113--332235444452111155BA11111123F8893--4423131162416213---1-------------21-1-3-4111121111--1112-11311-111-4-------------------------222--21-1-3---1-11-12---------------1---------1--2--3332322232-3333212323323332331------------------------31--1112-----------------------------321---------------1111111-213133332244353443423-------------3----------1123233----------2--------------1----------------------------2322-----12- ----111-----11-21222121121222232211111111112221211122211111111-----------1-----------------11-------1-1----22-823234922212525C151272-32412225126222212C12A2624526O2973769D8B334-11-A---135486275113111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 723 STR:RPRED 100.0 SQ:SECSTR TccTTcccccTTHHHHHTTccccGGGcccTTcEEEEEEEcccccEEEEEEEcTTGGGcTTEEEEETccEEccccccEEccTTcEEEEEEEccHHHHHHHHTTcEEEEEEccccccHHHHHHHTcccccTTcccEccccEEEEEccHHHHTTTccEEEEEEEEEcccccccccccEEEEEEccTcEEEEEccccHHHHHHHHHHHHTccGGGEEEEEccccccTTTTccTHHHHHHHHHHHHHHcccEEEEccHHHHHHHccccccEEEEEEEEEcTTccEEEEEEEEEEEEEcccTHHHHHHHHHTTTTTTcccccEEEEEEEEEcccccccccTTTTHHHHHHHHHHHHHHHHHHTTccHHHHHHHHcccTTcccTTTccccccccHHHHHHHHHHHTTHHHHHHHHHHHHHHcccEEEEEEEEEEEGGGcEEEEEEEEcTTccEEEEEccccccccHHHHHHHHHHHHHTccGGGEEcccEETTTccccccccTTTHHHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHTTcccEEEEEEEEEcccccccTTTTccccccEEEEEEEEEEEEEETTTccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHTccccccTTcccccccTTTcccccGGGcccEEEEEccccccTTcGGGccccccGGGHHHHHHHHHHHHHHTcccTTccccccccccHHHHHHHcc DISOP:02AL 722-724| PSIPRED ccccccccccccHHHHHccccEEEEcccccccEEEEEEEcccccEEEEEEEHHHHHHcccEEEEEcccccccccccEEEEcccEEEEEEEccHHHHHHHHHcccEEEEcccccccHHHHHHccccccccccccccccccccccccHHHHHHHccEEEEEEEEEcccccccccccEEEEEEEccEEEEEEccccHHHHHHHHHHHHcccHHHEEEEcccccccccccccccHHHHHHHHHHHHHcccEEEEEcHHHHHHcccccccEEEEEEEEEcccccEEEEEEEEEEccccccccHHHHHHHHHHHcccccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccEEccccHHHHHHHHHHHccHHHHHHHHHHHHccccEEEEEEEEEEEcccccccEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHcccHHHEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccEEEEccHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccHHcccccHHccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcc //