[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63831.1
DDBJ      :             chorismate mutase, conjectural
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:260 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->246 3egoA PDBj 1e-05 11.2 %
:RPS:SCOP  11->151 2f1kA2  c.2.1.6 * 6e-09 22.3 %
:HMM:SCOP  10->152 2g5cA2 c.2.1.6 * 5.8e-13 27.5 %
:RPS:PFM   61->178 PF02153 * PDH 2e-09 34.7 %
:HMM:PFM   56->198 PF02153 * PDH 3.8e-14 27.3 143/258  
:HMM:PFM   12->89 PF03807 * F420_oxidored 1.1e-05 32.1 78/96  
:BLT:SWISS 17->179 TYRA_ECOLI 3e-09 33.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63831.1 GT:GENE AAL63831.1 GT:PRODUCT chorismate mutase, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1143009..1143791) GB:FROM 1143009 GB:TO 1143791 GB:DIRECTION - GB:PRODUCT chorismate mutase, conjectural GB:NOTE Amino acid biosynthesis; Aromatic amino acid family GB:PROTEIN_ID AAL63831.1 GB:DB_XREF GI:18160481 LENGTH 260 SQ:AASEQ MFINWPSGSCMRVGIVGGGAMGSWLKREMTSLHEVRIFDVDKSRSDVGSLEELALWAEALIVAVPFWETSGVLKALAPLSRGRLVMDIATFKEGVVETYGLFPQDALVATVHPLFGPGASSIRGQRVLIMAVPGRRGAEEAFRFWSELGARAEWGELEKHDFYVSRTIALSYAVGLALARLYGELGDEVFKYGGTSFKYLATYAFSLLRDPNAAKYAEKAPIDEFIGFLKREDAPKALIDPDAAYRAFYKALEAMGEIQR GT:EXON 1|1-260:0| BL:SWS:NREP 1 BL:SWS:REP 17->179|TYRA_ECOLI|3e-09|33.1|154/373| SEG 50->60|leelalwaeal| RP:PDB:NREP 1 RP:PDB:REP 11->246|3egoA|1e-05|11.2|223/292| RP:PFM:NREP 1 RP:PFM:REP 61->178|PF02153|2e-09|34.7|118/255|PDH| HM:PFM:NREP 2 HM:PFM:REP 56->198|PF02153|3.8e-14|27.3|143/258|PDH| HM:PFM:REP 12->89|PF03807|1.1e-05|32.1|78/96|F420_oxidored| GO:PFM:NREP 2 GO:PFM GO:0004665|"GO:prephenate dehydrogenase (NADP+) activity"|PF02153|IPR003099| GO:PFM GO:0006571|"GO:tyrosine biosynthetic process"|PF02153|IPR003099| RP:SCP:NREP 1 RP:SCP:REP 11->151|2f1kA2|6e-09|22.3|139/165|c.2.1.6| HM:SCP:REP 10->152|2g5cA2|5.8e-13|27.5|142/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN 11----------------11111-----------------------------1----111-------- ---------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 95.0 SQ:SECSTR ##########cEEEEEcccHHHHHHHHHHHTTcEEEEEcccHHHHHcEEEccccccccEEEEcccGGGHHHHHHHTTcccccEEEEcccccHHHHHHHTcccccEEEEEEEccEEEcccEEEEEEcccEEEEEcTTccGGGGTTTTccccTTccEEEcccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTcTcTTHHHHcHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHTTTccHHHHHHHTTcT### DISOP:02AL 1-2, 5-6, 257-260| PSIPRED cEEEcccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHccEEEEEccHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHcccccEEEccccccccccccccccEEEEEEcccccHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //