[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63849.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->97 PF09943 * DUF2175 7e-14 50.5 %
:HMM:PFM   5->102 PF09943 * DUF2175 2.3e-41 60.2 98/101  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63849.1 GT:GENE AAL63849.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1158084..1158395) GB:FROM 1158084 GB:TO 1158395 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63849.1 GB:DB_XREF GI:18160500 LENGTH 103 SQ:AASEQ MRQLKKWKCAVCGEEIIEGQVFTFYSKGPVHWECLERELSGKVYKDADLAALLRLDHFLHEGIVLAKELEYLAQGEVAKERIREIRKQLEVLAAKLTNEITSK GT:EXON 1|1-103:0| SEG 46->56|dadlaallrld| RP:PFM:NREP 1 RP:PFM:REP 5->97|PF09943|7e-14|50.5|93/101|DUF2175| HM:PFM:NREP 1 HM:PFM:REP 5->102|PF09943|2.3e-41|60.2|98/101|DUF2175| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 101-103| PSIPRED ccccccEEEEEcccEEHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //