[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63852.1
DDBJ      :             ribosomal protein L23
Swiss-Prot:RL23_PYRAE   RecName: Full=50S ribosomal protein L23P;

Homologs  Archaea  65/68 : Bacteria  0/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->78 2zkrs PDBj 2e-16 46.2 %
:RPS:PDB   2->81 3bboV PDBj 2e-20 43.8 %
:RPS:SCOP  2->78 1jj2R  d.12.1.1 * 2e-20 42.9 %
:HMM:SCOP  1->75 1ffkP_ d.12.1.1 * 2.7e-19 45.3 %
:RPS:PFM   1->60 PF00276 * Ribosomal_L23 2e-07 52.5 %
:HMM:PFM   2->77 PF00276 * Ribosomal_L23 3.2e-19 49.3 75/92  
:BLT:SWISS 1->81 RL23_PYRAE 2e-40 100.0 %
:PROS 59->74|PS00050|RIBOSOMAL_L23

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63852.1 GT:GENE AAL63852.1 GT:PRODUCT ribosomal protein L23 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1160350..1160595 GB:FROM 1160350 GB:TO 1160595 GB:DIRECTION + GB:PRODUCT ribosomal protein L23 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63852.1 GB:DB_XREF GI:18160504 LENGTH 81 SQ:AASEQ MIKRIVVTEKALRLAEKENKITLIVDRGATKKQIAEEVERLYNVKVEKVNTLITPRGEKKAYVKLTKEHNAMDLLSKLGVL GT:EXON 1|1-81:0| SW:ID RL23_PYRAE SW:DE RecName: Full=50S ribosomal protein L23P; SW:GN Name=rpl23p; OrderedLocusNames=PAE1972; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->81|RL23_PYRAE|2e-40|100.0|81/81| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 59->74|PS00050|RIBOSOMAL_L23|PDOC00049| BL:PDB:NREP 1 BL:PDB:REP 1->78|2zkrs|2e-16|46.2|78/78| RP:PDB:NREP 1 RP:PDB:REP 2->81|3bboV|2e-20|43.8|80/85| RP:PFM:NREP 1 RP:PFM:REP 1->60|PF00276|2e-07|52.5|59/91|Ribosomal_L23| HM:PFM:NREP 1 HM:PFM:REP 2->77|PF00276|3.2e-19|49.3|75/92|Ribosomal_L23| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00276|IPR013025| GO:PFM GO:0005622|"GO:intracellular"|PF00276|IPR013025| GO:PFM GO:0005840|"GO:ribosome"|PF00276|IPR013025| GO:PFM GO:0006412|"GO:translation"|PF00276|IPR013025| RP:SCP:NREP 1 RP:SCP:REP 2->78|1jj2R|2e-20|42.9|77/81|d.12.1.1| HM:SCP:REP 1->75|1ffkP_|2.7e-19|45.3|75/78|d.12.1.1|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 440 OP:NHOMOORG 242 OP:PATTERN 111111111111111111111111111111111-111111111111111-111111111111-11111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1--1111-422111111111111111111-1111111111-1111111111111111111111111111111111111111111--22-13111111-1111132421--2111-111164111IB-G1AY9-35E--12C1-C1-112331-3-11111121111111-122111111F111114216121-111211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 100.0 SQ:SECSTR ccccccccHHHHHHHHTccEEccEEcTTccHHHHHHTTTTTccccEEEcccEEETTTEEEccEEEcTTTcTTTHHHHcccc PSIPRED ccccccccHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEcccccHHHHHHHHccc //