[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63860.1
DDBJ      :             aerolysin, part 2, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  272/915 : Eukaryota  106/199 : Viruses  0/175   --->[See Alignment]
c.41.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->200 2zwpB PDBj 6e-35 46.9 %
:RPS:PDB   8->192 3cnqS PDBj 5e-32 44.7 %
:RPS:SCOP  2->201 1a2qA  c.41.1.1 * 4e-36 44.5 %
:HMM:SCOP  2->210 1v6cA_ c.41.1.1 * 5.4e-58 47.2 %
:RPS:PFM   2->160 PF00082 * Peptidase_S8 1e-18 50.9 %
:HMM:PFM   2->200 PF00082 * Peptidase_S8 4.6e-39 39.4 193/307  
:BLT:SWISS 2->184 ISP_PAEPO 6e-38 46.4 %
:PROS 145->155|PS00138|SUBTILASE_SER
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63860.1 GT:GENE AAL63860.1 GT:PRODUCT aerolysin, part 2, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1165246..1165890 GB:FROM 1165246 GB:TO 1165890 GB:DIRECTION + GB:PRODUCT aerolysin, part 2, authentic frameshift GB:NOTE Protein fate; Degradation of proteins, peptides, and glycopeptides GB:PROTEIN_ID AAL63860.1 GB:DB_XREF GI:18160512 LENGTH 214 SQ:AASEQ MNNVSAAGVVPKVQLIAVKVLYDSGSGYYSDIAEGIIEAVKAGALILSMSLGGPTDASVLRDASYWAYQQGAVQIAAAGNSGDGDPLTNNVGYPAKYSCVIAAAAVDQNGSVPTWSSDGPEVDTAAPGVNILSTYPGGRYAYMSGTSMATPHVTGVAALIQALRLASGKRLLTPDEVYQVITSTAKDIGPPGFDVFSGYGLVDAYAAVVAALSR GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 2->184|ISP_PAEPO|6e-38|46.4|183/326| PROS 145->155|PS00138|SUBTILASE_SER|PDOC00125| SEG 202->211|vdayaavvaa| BL:PDB:NREP 1 BL:PDB:REP 2->200|2zwpB|6e-35|46.9|192/383| RP:PDB:NREP 1 RP:PDB:REP 8->192|3cnqS|5e-32|44.7|179/264| RP:PFM:NREP 1 RP:PFM:REP 2->160|PF00082|1e-18|50.9|159/285|Peptidase_S8| HM:PFM:NREP 1 HM:PFM:REP 2->200|PF00082|4.6e-39|39.4|193/307|Peptidase_S8| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00082|IPR000209| GO:PFM GO:0006508|"GO:proteolysis"|PF00082|IPR000209| RP:SCP:NREP 1 RP:SCP:REP 2->201|1a2qA|4e-36|44.5|191/275|c.41.1.1| HM:SCP:REP 2->210|1v6cA_|5.4e-58|47.2|199/0|c.41.1.1|1/1|Subtilisin-like| OP:NHOMO 982 OP:NHOMOORG 398 OP:PATTERN 111-------------1-11-1-1-112--21---------------81--2---3-234-------- --2-2------------11-1---1-1-1111----2-11-21213-2-111324211--48-18536781---------112----------1-----1111111--32---------------1--1---113133335-1-72132-11311----11-211-14334----1--1----G3713--1-242222232233223323777563323233443------641---1-------------------------------------------------------------------------------------311-2----------1111----1----3--1---11-242-11-211--1--1----------1--11-1--11------------11---2---1---------1--1111--13------1-1--------------------------------------------------------1----121111----2222-211-2--1-----2-------------1------------2132--A-2------------122-412--11-16--2---------------------------1--22-4212-2111161242113222124--31-11--------------------------------------------------------------------------------------------A-----11112-3-----------------11111---------------1-------------------1-2-----221111256565112--------------------------------------------------3-121-1----2- 11-1-21-1---1345343233222222222226677959988-111-55988A3243311133211--2-21312223324432321----34-1--11-2-777-1B15----------------------------------------------------3------------14--1--551-1-4-223-1125 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 93.5 SQ:SECSTR #cccccHHHcTTcEEEEEEcccTTccccHHHHHHHHHHHHHTTccEEEEccccccccHHHHHHHHHHHHTTcEEEEEcccccccTTTccccccTTTcTTcEEEEEEcTTccccTTccccTTccEEEEcccEEEEETTTEEEEEccHHHHHHHHHHHHHHHHHHcHHHHcTTccHHHHHHHHHHTccccccHHHcTHHTTcc############# DISOP:02AL 214-215| PSIPRED cccccEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccccHHHHccccccccccccccccccccEEEEEccccEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccEEEcHHHHHHccccc //