[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63871.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->110 PF08325 * WLM 0.00025 30.4 69/184  
:PROS 82->91|PS00142|ZINC_PROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63871.1 GT:GENE AAL63871.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1176079..1176471) GB:FROM 1176079 GB:TO 1176471 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63871.1 GB:DB_XREF GI:18160524 LENGTH 130 SQ:AASEQ MAYIRLASVEADIKNAVVRHNLNHLFQVDIVVVYNPNSHSKAVARIWGINKIFQEVLGLNPVYIMELLRPFKRLSCAERVKVIAHELAHIPATKSGALRPHNKAFWRDYKLYAGLFKCEDFPSLKINAGF GT:EXON 1|1-130:0| PROS 82->91|PS00142|ZINC_PROTEASE|PDOC00129| HM:PFM:NREP 1 HM:PFM:REP 24->110|PF08325|0.00025|30.4|69/184|WLM| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN 11--11-11111111-1-11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-7| PSIPRED ccEEEcccHHHHHHHHHHHHcccEEEEEEEEEEEccccccHHHHHHHHcHHHHHHHHccccEEEEEEEHHcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccEEEEccc //