[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63881.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->75 1v8cB PDBj 1e-04 36.6 %
:RPS:PDB   3->90 3dwgC PDBj 3e-10 27.3 %
:RPS:SCOP  1->90 1wgkA  d.15.3.3 * 7e-10 21.1 %
:HMM:SCOP  1->90 1wgkA_ d.15.3.3 * 4.3e-20 41.1 %
:RPS:PFM   13->90 PF02597 * ThiS 2e-04 41.4 %
:HMM:PFM   4->85 PF02597 * ThiS 9.9e-12 34.2 73/78  
:BLT:SWISS 3->90 Y821_SYNY3 2e-07 28.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63881.1 GT:GENE AAL63881.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1185513..1185785) GB:FROM 1185513 GB:TO 1185785 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63881.1 GB:DB_XREF GI:18160535 LENGTH 90 SQ:AASEQ MPRVKLAGVLVALAGGRDEVVLEGATVKEILSALSSISPKLYKRVVGEDGRPRADIYIAVNDVDIRLLSGLNTPVKKDDVVLLLAYIHPG GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 3->90|Y821_SYNY3|2e-07|28.4|88/109| BL:PDB:NREP 1 BL:PDB:REP 2->75|1v8cB|1e-04|36.6|71/160| RP:PDB:NREP 1 RP:PDB:REP 3->90|3dwgC|3e-10|27.3|88/92| RP:PFM:NREP 1 RP:PFM:REP 13->90|PF02597|2e-04|41.4|70/79|ThiS| HM:PFM:NREP 1 HM:PFM:REP 4->85|PF02597|9.9e-12|34.2|73/78|ThiS| GO:PFM:NREP 1 GO:PFM GO:0006790|"GO:sulfur metabolic process"|PF02597|IPR003749| RP:SCP:NREP 1 RP:SCP:REP 1->90|1wgkA|7e-10|21.1|90/114|d.15.3.3| HM:SCP:REP 1->90|1wgkA_|4.3e-20|41.1|90/0|d.15.3.3|1/1|MoaD/ThiS| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 98.9 SQ:SECSTR #cEEEccGGGGGGTTTccEEEEccccHHHHHHHHHHHcTTHHHHHcccTTcccTTEEEEETTEEGGGTTGGGccccTTcEEEEEEccTTc DISOP:02AL 90-91| PSIPRED ccEEEEEHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHccccccccccEEEEEcccccc //