[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63895.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:108 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->102 2gw8A PDBj 4e-04 26.8 %
:RPS:SCOP  32->102 1gnkA  d.58.5.1 * 5e-06 18.3 %
:RPS:PFM   15->105 PF08734 * GYD 6e-16 42.9 %
:HMM:PFM   15->105 PF08734 * GYD 4.9e-31 41.8 91/91  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63895.1 GT:GENE AAL63895.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1195907..1196233 GB:FROM 1195907 GB:TO 1196233 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63895.1 GB:DB_XREF GI:18160550 LENGTH 108 SQ:AASEQ MYKNPLKIFSNIVWFVVLSKLTDEGAKTLKEKPERVKEVNKELESYGVRVVYQFVTFGEYDFVNIVEVDRPENLLRALIEINSRGSVRTTTLYAFPVDEAIKALKSQT GT:EXON 1|1-108:0| TM:NTM 1 TM:REGION 3->25| BL:PDB:NREP 1 BL:PDB:REP 32->102|2gw8A|4e-04|26.8|71/99| RP:PFM:NREP 1 RP:PFM:REP 15->105|PF08734|6e-16|42.9|91/91|GYD| HM:PFM:NREP 1 HM:PFM:REP 15->105|PF08734|4.9e-31|41.8|91/91|GYD| RP:SCP:NREP 1 RP:SCP:REP 32->102|1gnkA|5e-06|18.3|71/98|d.58.5.1| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------1111111----11---1-------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------11--------1-----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 65.7 SQ:SECSTR ###############################cGGGHHHHHHHHHHTTccEEEEEEEEccccEEEEEEEGGHHHHHHHHHHHHccccTTccEEEEEEEccccc###### DISOP:02AL 1-3, 106-108| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHcc //