[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63897.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   17->44 1bunA PDBj 5e-04 32.1 %
:HMM:PFM   21->47 PF01909 * NTP_transf_2 0.0003 40.0 25/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63897.1 GT:GENE AAL63897.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1196978..1197217) GB:FROM 1196978 GB:TO 1197217 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63897.1 GB:DB_XREF GI:18160552 LENGTH 79 SQ:AASEQ MDVVVGRAYKVSLEALKRFPWGKYVKFAFLFGSASSGGPAGDLDIAISKISLEAFGDLLADLAKYLSPPRGLYRLSSSD GT:EXON 1|1-79:0| RP:PDB:NREP 1 RP:PDB:REP 17->44|1bunA|5e-04|32.1|28/120| HM:PFM:NREP 1 HM:PFM:REP 21->47|PF01909|0.0003|40.0|25/93|NTP_transf_2| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------11-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 76-79| PSIPRED ccEEcccHHHHHHHHHHcccccccEEEEEEEEHHccccccccEEEEEEEHHHHHHHHHHHHHHHHccccccEEEccccc //