[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63899.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->79 PF03010 * GP4 0.00059 41.0 39/152  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63899.1 GT:GENE AAL63899.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1198796..1199275) GB:FROM 1198796 GB:TO 1199275 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63899.1 GB:DB_XREF GI:18160554 LENGTH 159 SQ:AASEQ MRPVIGVLAGLLQYFMFASHPVLSLYPRAVDGALGQGAFAAVLLLVNLAVSLRHPYTSAFTALTLYLAEVALSSPVLRLFIPLPELPAPDVTYGAAIVLLLIAASAEGLLGLYLASTGLPAAAVLALKDLAPRLDYPLALALLITGLVLVAITTRSSRG GT:EXON 1|1-159:0| TM:NTM 5 TM:REGION 5->27| TM:REGION 31->52| TM:REGION 63->85| TM:REGION 99->121| TM:REGION 133->154| SEG 40->52|aavlllvnlavsl| SEG 95->106|aaivllliaasa| SEG 138->154|lalallitglvlvaitt| HM:PFM:NREP 1 HM:PFM:REP 41->79|PF03010|0.00059|41.0|39/152|GP4| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 156-159| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHEEEccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccc //