[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63900.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:310 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   149->178 PF01882 * DUF58 3e-08 66.7 %
:HMM:PFM   148->201 PF01882 * DUF58 2.2e-19 40.7 54/86  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63900.1 GT:GENE AAL63900.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1199272..1200204) GB:FROM 1199272 GB:TO 1200204 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63900.1 GB:DB_XREF GI:18160555 LENGTH 310 SQ:AASEQ MARNMLTVAAVLLAAGLALGSPDAALLSLIPLFAYSLNAWMEPPKIAVFKRRVGSQVEIIIESDRKPGIIYIYEAAPINAPVRPLRRRVFKPPFRRILKIQYYMAEKSQPLPLVAESYNPAFTKRRTAVYTEEPRLDASPEPRGPGVEEFLEVRPYQPGDPVKLINWKAFAKTGELYVNTRIGPETRSAVVVVDARRLRSLVIAEAVRAAEILSEKGYDVVYYVLGHGLAPSLPRSFTPSCEGSPPCGDVTVYVGSLADVCLILKCKPAYYIDVAGVNSLVAVKRLKLYRELRAAGAEVLRGAEELRRAV GT:EXON 1|1-310:0| TM:NTM 1 TM:REGION 10->32| SEG 8->29|vaavllaaglalgspdaallsl| RP:PFM:NREP 1 RP:PFM:REP 149->178|PF01882|3e-08|66.7|30/86|DUF58| HM:PFM:NREP 1 HM:PFM:REP 148->201|PF01882|2.2e-19|40.7|54/86|DUF58| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN ------------------111---------------------------------1---11-------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 127-148, 236-244, 309-310| PSIPRED ccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccEEEEEEEEEEcccEEEEEEcccccEEEEEEEcEEEEcccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHccccccccccEEccccEEccccEEEEEEEcccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccEEccccccccccccEEEEHHHHHHEEEHEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //