[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63917.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  84/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->108 3e4vA PDBj 8e-12 32.0 %
:RPS:PDB   5->179 1ejeA PDBj 3e-25 20.1 %
:RPS:SCOP  5->179 1ejeA  b.45.1.2 * 2e-25 20.1 %
:HMM:SCOP  1->179 1ejeA_ b.45.1.2 * 2.8e-42 34.3 %
:RPS:PFM   9->108 PF01613 * Flavin_Reduct 6e-13 40.0 %
:HMM:PFM   11->149 PF01613 * Flavin_Reduct 2.9e-32 31.2 138/155  
:BLT:SWISS 8->97 YDDH_ECOLI 8e-13 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63917.1 GT:GENE AAL63917.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1214438..1214980 GB:FROM 1214438 GB:TO 1214980 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63917.1 GB:DB_XREF GI:18160574 LENGTH 180 SQ:AASEQ MYEGKFYRLLHPRPTVVIVTKCPNGRFNLMPASWNTPVSEEPPTIAVAVDKESYTHQCLRHYKYATINVPPIDAADLIYKLGTTSGREVDKAAQFGVKLEPSSKIDVPRMSGALAAYEAEVYKEVEVGEVVLYIFRVLDVWTAPGVADQWGFDFKKVNIPLHGAGRAFYRVDPRPVFAKK GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 8->97|YDDH_ECOLI|8e-13|36.7|90/189| SEG 113->133|alaayeaevykevevgevvly| BL:PDB:NREP 1 BL:PDB:REP 7->108|3e4vA|8e-12|32.0|97/173| RP:PDB:NREP 1 RP:PDB:REP 5->179|1ejeA|3e-25|20.1|174/192| RP:PFM:NREP 1 RP:PFM:REP 9->108|PF01613|6e-13|40.0|100/150|Flavin_Reduct| HM:PFM:NREP 1 HM:PFM:REP 11->149|PF01613|2.9e-32|31.2|138/155|Flavin_Reduct| RP:SCP:NREP 1 RP:SCP:REP 5->179|1ejeA|2e-25|20.1|174/192|b.45.1.2| HM:SCP:REP 1->179|1ejeA_|2.8e-42|34.3|178/192|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 107 OP:NHOMOORG 101 OP:PATTERN --1121-1--------2-11111------1--------------------------1-1-1---1--- ---------------------------------------------------------------------------------1-----------------------1--------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------11-------1-11-----11------------------------1---1-----------1------1-----------------------------------1--11-1---------------------1------------------------------------------1----------1------11--------2-111--11--1------12----1211-------------1--------------------1---------1------------------------------------------------------------------------1--1-1-1--1111111--111111111-11111112111---------------------1----------------------------------------------------------------1------11-----1----------------------------11-1-11----------1------------------------------------------1-----1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 98.9 SQ:SECSTR #cccGGGGTcccEEcEEEEEEcTTccEEEEEEccEEEEETTTTEEEEEEcTTcHHHHHHHHHcEEEEEEccGGGHHHHHHTTccccTTccHHHHHTccEEccccccccEETTccEEEEEEEEEEEEETTEEEEEEEEEEEEEcTTcEETTEEcHHHHcccEEEEETTEEEEcccccccc# DISOP:02AL 1-2, 176-180| PSIPRED cccccccEEEEcccEEEEEEcccccEEEEEEEEEEEEEcccccEEEEEEcccHHHHHHHHHccEEEEEEccHHHHHHHHHHHHcccccccHHHHcccEEEccccccccEEcccEEEEEEEEEEEEEcccEEEEEEEEEEEEEccHHHccccccccccccEEEEEccEEEEEccccccccc //