[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63943.1
DDBJ      :             ribosomal protein S14
Swiss-Prot:RS14_PYRAE   RecName: Full=30S ribosomal protein S14P;

Homologs  Archaea  52/68 : Bacteria  0/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->52 2zkqn PDBj 1e-08 46.5 %
:RPS:PDB   4->53 3bbnN PDBj 1e-07 27.1 %
:HMM:PFM   4->53 PF00253 * Ribosomal_S14 6.2e-20 47.9 48/55  
:BLT:SWISS 1->54 RS14_PYRAE 4e-30 100.0 %
:PROS 21->42|PS00527|RIBOSOMAL_S14

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63943.1 GT:GENE AAL63943.1 GT:PRODUCT ribosomal protein S14 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1236092..1236256 GB:FROM 1236092 GB:TO 1236256 GB:DIRECTION + GB:PRODUCT ribosomal protein S14 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63943.1 GB:DB_XREF GI:18160602 LENGTH 54 SQ:AASEQ MPSTKPPKERPYGKSKIRCLRCGTREAVIRKYGLYLCRRCFREVAPQLGFKKYY GT:EXON 1|1-54:0| SW:ID RS14_PYRAE SW:DE RecName: Full=30S ribosomal protein S14P; SW:GN Name=rps14p; OrderedLocusNames=PAE2097; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->54|RS14_PYRAE|4e-30|100.0|54/54| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 21->42|PS00527|RIBOSOMAL_S14|PDOC00456| BL:PDB:NREP 1 BL:PDB:REP 10->52|2zkqn|1e-08|46.5|43/49| RP:PDB:NREP 1 RP:PDB:REP 4->53|3bbnN|1e-07|27.1|48/99| HM:PFM:NREP 1 HM:PFM:REP 4->53|PF00253|6.2e-20|47.9|48/55|Ribosomal_S14| OP:NHOMO 56 OP:NHOMOORG 55 OP:PATTERN 11111111111111111111111---------111---11111--1111111111111111-11-111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------1----------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 92.6 SQ:SECSTR ###ccccccccGGGcccccccccccccccTTTcccccTTHHHHHHTTcccccc# DISOP:02AL 1-6, 8-11| PSIPRED cccccccccccccccccEEEEEcccccEEEEccHHHHHHHHHHHHHHcccEEcc //