[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63947.1
DDBJ      :             ribosomal protein L18
Swiss-Prot:RL18_PYRAE   RecName: Full=50S ribosomal protein L18P;

Homologs  Archaea  68/68 : Bacteria  0/915 : Eukaryota  168/199 : Viruses  0/175   --->[See Alignment]
a.47.2c.55.4
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->184 1jj2M PDBj 1e-38 45.9 %
:RPS:PDB   11->129 3bboQ PDBj 1e-18 16.2 %
:RPS:SCOP  40->129 1vs6O1  c.55.4.1 * 1e-18 27.9 %
:RPS:SCOP  140->183 1hs7A  a.47.2.1 * 1e-10 25.0 %
:HMM:SCOP  2->198 1ffkK_ c.55.4.1 * 6.1e-63 51.6 %
:RPS:PFM   40->129 PF00861 * Ribosomal_L18p 2e-05 34.1 %
:HMM:PFM   11->130 PF00861 * Ribosomal_L18p 8.5e-35 40.7 118/119  
:BLT:SWISS 1->205 RL18_PYRAE 8e-94 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63947.1 GT:GENE AAL63947.1 GT:PRODUCT ribosomal protein L18 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1237621..1238238 GB:FROM 1237621 GB:TO 1238238 GB:DIRECTION + GB:PRODUCT ribosomal protein L18 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL63947.1 GB:DB_XREF GI:18160606 LENGTH 205 SQ:AASEQ MARSGRYKVPFRRRREGLTNYRKRRKLLLSKKPRLVVRKTNKHIIAQIVVAKPQGDVTIVGADTRILAKFGWRGDENNVAAAYLLGLVVGYKARARRVEEAILDIGLHRPAPGARVFAVLKGALDAGLKIPHGEEVLPDEDRIKGKHVAEYAEKLKEENPEAYKARFSRYLQRGLEPEKLPEHFEEVKKKIVEYYEKKLAKVAAQ GT:EXON 1|1-205:0| SW:ID RL18_PYRAE SW:DE RecName: Full=50S ribosomal protein L18P; SW:GN Name=rpl18p; OrderedLocusNames=PAE2101; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|RL18_PYRAE|8e-94|100.0|205/205| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| SEG 22->39|rkrrklllskkprlvvrk| SEG 185->198|eevkkkiveyyekk| BL:PDB:NREP 1 BL:PDB:REP 2->184|1jj2M|1e-38|45.9|172/186| RP:PDB:NREP 1 RP:PDB:REP 11->129|3bboQ|1e-18|16.2|117/122| RP:PFM:NREP 1 RP:PFM:REP 40->129|PF00861|2e-05|34.1|88/118|Ribosomal_L18p| HM:PFM:NREP 1 HM:PFM:REP 11->130|PF00861|8.5e-35|40.7|118/119|Ribosomal_L18p| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00861|IPR005484| GO:PFM GO:0005622|"GO:intracellular"|PF00861|IPR005484| GO:PFM GO:0005840|"GO:ribosome"|PF00861|IPR005484| GO:PFM GO:0006412|"GO:translation"|PF00861|IPR005484| RP:SCP:NREP 2 RP:SCP:REP 40->129|1vs6O1|1e-18|27.9|86/117|c.55.4.1| RP:SCP:REP 140->183|1hs7A|1e-10|25.0|44/97|a.47.2.1| HM:SCP:REP 2->198|1ffkK_|6.1e-63|51.6|186/0|c.55.4.1|1/1|Translational machinery components| OP:NHOMO 315 OP:NHOMOORG 236 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111111-4321111111111111111111111111111111111111111111111111111-1111-111111111111---1-22-11111111111111---111112322211113-1113-311E1-1261--121122-111-1--11212-121111115111112111--K2111-41321-1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 89.3 SQ:SECSTR #cccTTcccccccccccGGGTccccccGGGGcccccccEccccEEEEEEccTTccEEEEEEHHHHHHHHccTTcccccHHHHHHHHHHcccHHHHTccccccccccccccccccTTHHHHHHHTTTTccEcccGGGccccHHHHTHHHHHHHHTcccccTcccccccEEEETTEEcccccHHHH##################### DISOP:02AL 1-2, 194-205| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEEccccccEEEEEEEccHHHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccc //