[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63959.1
DDBJ      :             conjugal transfer protein, conjectural
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:343 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   145->310 2pt7C PDBj 6e-09 25.2 %
:RPS:PDB   187->225 3czpA PDBj 1e-06 20.5 %
:RPS:PDB   259->341 1dmaB PDBj 4e-07 12.0 %
:RPS:SCOP  147->321 1p9rA  c.37.1.11 * 8e-17 21.3 %
:HMM:SCOP  75->314 1g6oA_ c.37.1.11 * 5.6e-24 24.9 %
:RPS:PFM   84->310 PF00437 * GSPII_E 4e-10 27.8 %
:HMM:PFM   69->320 PF00437 * GSPII_E 1.9e-26 27.4 248/282  
:BLT:SWISS 76->312 TRBB_RHISN 2e-12 26.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63959.1 GT:GENE AAL63959.1 GT:PRODUCT conjugal transfer protein, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1247580..1248611) GB:FROM 1247580 GB:TO 1248611 GB:DIRECTION - GB:PRODUCT conjugal transfer protein, conjectural GB:NOTE Unclassified GB:PROTEIN_ID AAL63959.1 GB:DB_XREF GI:18160619 LENGTH 343 SQ:AASEQ MYPILKRLLECAECKSSCVEKGICDFAKEELPLVIKLLSRVFKKSIDETLDFRYGVLRRINEKMAIRGVLATVGLEELSPFLEDREVEDIVVIPGRPIYITRKSGKEKADVTAELKTVKSLLKIAYLKGVELTTSNPSLRYGLKLGDLRLRISLDLPPVVPVPQAYIRIHRGKIAVADMLKSGFITEEQLKTVYAWVKEGRHIVITGPPGSGKTTLLSVIDDLIPGQLQRVYIDEADEFDDDPDKNQIKIRNVNKLREVYASLNRNIDIIIIGELQYEEHFNAFKTAVEIGLQTLATMHATSVKDALKRLERRGISRENLAIIQLAKRYDEGIERRVVELYAS GT:EXON 1|1-343:0| BL:SWS:NREP 1 BL:SWS:REP 76->312|TRBB_RHISN|2e-12|26.8|235/325| SEG 234->244|deadefdddpd| BL:PDB:NREP 1 BL:PDB:REP 145->310|2pt7C|6e-09|25.2|159/307| RP:PDB:NREP 2 RP:PDB:REP 187->225|3czpA|1e-06|20.5|39/460| RP:PDB:REP 259->341|1dmaB|4e-07|12.0|83/189| RP:PFM:NREP 1 RP:PFM:REP 84->310|PF00437|4e-10|27.8|223/273|GSPII_E| HM:PFM:NREP 1 HM:PFM:REP 69->320|PF00437|1.9e-26|27.4|248/282|GSPII_E| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00437|IPR001482| GO:PFM GO:0005622|"GO:intracellular"|PF00437|IPR001482| GO:PFM GO:0006810|"GO:transport"|PF00437|IPR001482| RP:SCP:NREP 1 RP:SCP:REP 147->321|1p9rA|8e-17|21.3|174/378|c.37.1.11| HM:SCP:REP 75->314|1g6oA_|5.6e-24|24.9|233/323|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 70 OP:NHOMOORG 62 OP:PATTERN ---1-1-----------122222-----11-------------1-1-------1----------11-- --2-----------------------------------------1---1------------------111------------------------------------------------------------1-----211-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-1---11---------------1-----1----------1------1---------------------1----1-----1-1-----------------------------11-------------------------------------1--1---1-----1-------------------1-------------11--------1-----------------------------1---1----1-1--------------------------------11------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------1-11---------11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 343-344| PSIPRED ccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHccccccEEEEEcccEEEEEEccEEEEcccccHHHHHHHHHHHHHHccccccccccEEEEEEEcccEEEEEEEEEccccccEEEEEEEccccccHHHHHHcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHccccccEEEEEccHHHcccccEEEEccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEEEEEcc //