[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63978.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->47 PF12518 * DUF3721 0.00033 45.5 11/34  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63978.1 GT:GENE AAL63978.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1264390..1264566 GB:FROM 1264390 GB:TO 1264566 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63978.1 GB:DB_XREF GI:18160639 LENGTH 58 SQ:AASEQ MPGVADIYYGTFHDSIDFDDVANVPYHFAITIFHPSARSMGCSGAFATIFATLVDVKN GT:EXON 1|1-58:0| HM:PFM:NREP 1 HM:PFM:REP 37->47|PF12518|0.00033|45.5|11/34|DUF3721| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-25,58-59| PSIPRED ccccEEEEEEEEcccccHHHHccccEEEEEEEEccccccccccHHHHHHHHHHHHccc //