[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63981.1
DDBJ      :             conserved hypothetical protein part 1, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:240 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   3->144 2a5hA PDBj 8e-11 11.0 %
:RPS:SCOP  4->144 1tv7A  c.1.28.3 * 7e-13 25.6 %
:HMM:SCOP  3->217 1tv8A_ c.1.28.3 * 6e-21 23.2 %
:RPS:PFM   6->144 PF04055 * Radical_SAM 2e-04 28.9 %
:HMM:PFM   5->141 PF04055 * Radical_SAM 7.3e-16 20.6 131/166  
:BLT:SWISS 5->218 YYDG_BACSU 7e-12 25.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63981.1 GT:GENE AAL63981.1 GT:PRODUCT conserved hypothetical protein part 1, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1265617..1266339) GB:FROM 1265617 GB:TO 1266339 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein part 1, authentic frameshift GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63981.1 GB:DB_XREF GI:18160642 LENGTH 240 SQ:AASEQ MYSYKCNFLCKHCSVGAGPFHDELLPIETIEKVLDQAYYISSIKVVAAAGGEPTLYLSHLRTLLKKAADLSFITRVVTNAWWASTPQRTYHFLDDLRALGLEELNISYDDFHDEWLSRYGGWRNIVNAVRAAVDLGLRTVIAVVRAKNSLITANVIRERLKLEGLDNKVLILEDFLSPTSRAKGLETVINVSGYGCGDVGHLSVHPNGDVAFCCGHIINDPESGWFTRIGNIYREISQTL GT:EXON 1|1-240:0| BL:SWS:NREP 1 BL:SWS:REP 5->218|YYDG_BACSU|7e-12|25.6|195/319| RP:PDB:NREP 1 RP:PDB:REP 3->144|2a5hA|8e-11|11.0|136/400| RP:PFM:NREP 1 RP:PFM:REP 6->144|PF04055|2e-04|28.9|135/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 5->141|PF04055|7.3e-16|20.6|131/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 4->144|1tv7A|7e-13|25.6|133/327|c.1.28.3| HM:SCP:REP 3->217|1tv8A_|6e-21|23.2|207/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 24 OP:NHOMOORG 23 OP:PATTERN ---11-------------21----------------------------1------111---------- ------------------------------------------1---------------------------------------------1---------------------------------------11------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1----------1---------------1----------------------------------------------------------1--------------------------------------------------------------------------------------------1-----------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------1------------------------------------------------------------1------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 67.5 SQ:SECSTR GEEEEcccccTTcTTTTTTTccccccHHHHHHHHHHHTcTTccEEEEEEccTTcccHHHHHHHHHHHHTcTTccEETTTEEEccHHHHcGGGccHHHHHHGGGccccTEEEEEccccGGGccHHHHHHHHHHHHTTccEEEEEEHccTTTccHHHHHHHHHH############################################################################## PSIPRED ccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEccccccHHHcccHHHHccccccccccEEEEcccccEEEccHHHHccHHccccEEccccHHHHHHHc //