[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63983.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63983.1 GT:GENE AAL63983.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1266794..1267222 GB:FROM 1266794 GB:TO 1267222 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63983.1 GB:DB_XREF GI:18160645 LENGTH 142 SQ:AASEQ MPARFVIEIWIYAMSLLTIVLPLYYVNWNISKIPLPLAIVVFTPPVIIITFFMPKKFLLENGVVKLCSLTRCKEYQVLEDKGFVDRKDVWKRYMFCSGWRFPLSAWALCPDGNMYFSTLRCNDKWRVLRIKNKEEYTLWLCG GT:EXON 1|1-142:0| TM:NTM 2 TM:REGION 4->26| TM:REGION 40->62| SEG 39->52|ivvftppviiitff| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------1-1----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccEEccccEEEEEEcccHHEEEEcccHHHHHHccHHHHHHHHcccccEEEcccccccHHHHHHHHHHHccccccccEEEEcccccEEEEEEEEcccEEEEEEEccccEEEEEEc //