[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63999.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:161 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63999.1 GT:GENE AAL63999.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1280300..1280785) GB:FROM 1280300 GB:TO 1280785 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63999.1 GB:DB_XREF GI:18160662 LENGTH 161 SQ:AASEQ MLSALDIKVKRILWGLAAEFAYLAVVGTTIVPPCSLLKRRVSRVVSPEVLSFLAAKLGGDDPEVRLNSMLGMRLSGVPKCEILNGTLPELYELCTALRRWGREPLFKVAREVVIPLAVSASAAGYEEGEVLLTSYRAASGRGARDLDAVVKYFNKWYLIRF GT:EXON 1|1-161:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 103->124| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccHHHHHHHHHHHHEEEEEc //