[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64031.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->142 1mhpA PDBj 8e-04 29.4 %
:RPS:PDB   238->296 1bifA PDBj 2e-04 5.1 %
:RPS:SCOP  232->293 1f2t.1  c.37.1.12 * 2e-04 19.7 %
:HMM:SCOP  20->293 1ye8A1 c.37.1.11 * 9e-07 24.6 %
:BLT:SWISS 176->257 SRTF_STRPY 5e-04 34.2 %
:BLT:SWISS 228->293 XYLG_PSE14 7e-04 31.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64031.1 GT:GENE AAL64031.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1306782..1307705 GB:FROM 1306782 GB:TO 1307705 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64031.1 GB:DB_XREF GI:18160696 LENGTH 307 SQ:AASEQ MIEYVEVGLGGRKAAVRLTNVVFVTGTGKSTFLKLVYGVLSSVGKRLPKLGIEWSFYAQSGEVIYSITATRNRVRQTISTQGEEIAFEFVPAKGAHRLIKPIDIAVTDADVVMPEVKTKEHVSVVADEDIERLNSLLLAARKAFSVKAQFLGPYISPRSLVDASTKQINALERHGRNLAAVLSNLALYNPSAYDSIRTAFRKLGFSISVGLAKPGFVGVIVSTKRGKMPLSKAPCSIKSLLAIAVALELKPDLLLIDNLDYCLTKNTAEALAAILRQKSTKVIAEIHNSEVVDWFNLPNKSVVELML GT:EXON 1|1-307:0| BL:SWS:NREP 2 BL:SWS:REP 176->257|SRTF_STRPY|5e-04|34.2|79/229| BL:SWS:REP 228->293|XYLG_PSE14|7e-04|31.8|66/100| BL:PDB:NREP 1 BL:PDB:REP 57->142|1mhpA|8e-04|29.4|85/184| RP:PDB:NREP 1 RP:PDB:REP 238->296|1bifA|2e-04|5.1|59/432| RP:SCP:NREP 1 RP:SCP:REP 232->293|1f2t.1|2e-04|19.7|61/288|c.37.1.12| HM:SCP:REP 20->293|1ye8A1|9e-07|24.6|138/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 46.9 SQ:SECSTR ########################################################cccHHHHHHHHHTcccccccccHHHHHHHHHHTcGGGTccTTcEEEEEEEEccc#cTTcTTHHHHHHHHHHTTEEEEEEEEcccHH###############################################################################################HHHHHHHHHHHHHHTcEEEEcccHHHHHHHHHHHTTTcTTTTTccHHHHHHHHHHHHHH########### DISOP:02AL 53-53,67-67,81-81,87-88,90-90,95-96,101-102,104-104,109-109,123-124,129-130,132-132,137-138,143-143,146-146,165-165,171-172,174-174,179-180,193-193,199-200,202-202,207-207,221-221,235-235,241-241,244-244,249-249| PSIPRED ccEEEEEcccccEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEEcHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEcccEEccccccccEEEEEEccHHHHHHHHHHHHHHccEEEHHHccccccHHHHHccHHHHHHHHHHccccHHHHHHcccccccHHHHHHHHHHHHcccEEEEEcccccEEEEEEEccccccccccccccHHHHHHHHHEEEccccEEEEEcccHHHcccHHHHHHHHHHHHHHHHHHHHHcccEEEHHccccHHHHHHcc //