[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64059.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   129->154 PF11894 * DUF3414 3e-04 61.5 %
:HMM:PFM   85->113 PF12244 * DUF3606 0.00037 41.4 29/57  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64059.1 GT:GENE AAL64059.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1331402..1331917 GB:FROM 1331402 GB:TO 1331917 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64059.1 GB:DB_XREF GI:18160726 LENGTH 171 SQ:AASEQ MSLKVIVLTEGVAVREEGDVIIDAAGQPQFFDVIILSGKELKSIVATGVVNIGVPIGIGKYTKKPVAAVVGDKVYIKGIPLTLYKETGMLERELAEALKKTGNETEAVLKKLKEIVISERRRHKKSHTLSILSKYISGEIDELPPHLADIVGSLDKDSLRSVFEKLVEDVY GT:EXON 1|1-171:0| SEG 48->59|gvvnigvpigig| RP:PFM:NREP 1 RP:PFM:REP 129->154|PF11894|3e-04|61.5|26/1499|DUF3414| HM:PFM:NREP 1 HM:PFM:REP 85->113|PF12244|0.00037|41.4|29/57|DUF3606| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-26,31-32,34-34,39-39,73-73,76-76,81-81,101-102,104-104,109-109,123-123,129-129,157-158,160-160,171-172| PSIPRED ccEEEEEEEccEEEEccccEEEEccccccEEEEEEEccHHHHHHHHHHHHHccccccccccccccHHHHHccEEEEEEEEEEEEHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHcccHHHHHHHHHHHHHHHc //