[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64065.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->91 PF03334 * PhaG_MnhG_YufB 6e-06 36.1 36/81  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64065.1 GT:GENE AAL64065.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1336047..1336352 GB:FROM 1336047 GB:TO 1336352 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64065.1 GB:DB_XREF GI:18160733 LENGTH 101 SQ:AASEQ MKEILVILLITAVVFAATNSTDPFVKISQTVESILSSIDKFLQNLKDVLKTHMVSISRTLSVILGLVGAVLYFSGLNKYSGRGLIIGAILLYILADFISSI GT:EXON 1|1-101:0| TM:NTM 2 TM:REGION 1->23| TM:REGION 79->101| SEG 83->95|gliigaillyila| HM:PFM:NREP 1 HM:PFM:REP 50->91|PF03334|6e-06|36.1|36/81|PhaG_MnhG_YufB| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,101-102| PSIPRED cHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc //