[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64089.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->54 PF05762 * VWA_CoxE 0.00018 26.7 45/222  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64089.1 GT:GENE AAL64089.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1359659..1359841 GB:FROM 1359659 GB:TO 1359841 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64089.1 GB:DB_XREF GI:18160759 LENGTH 60 SQ:AASEQ MEKILRLISELGGEADLDAIITAALKTGIPPPLATRQLMRLVEKGRVKIVCDASIKYRVV GT:EXON 1|1-60:0| HM:PFM:NREP 1 HM:PFM:REP 10->54|PF05762|0.00018|26.7|45/222|VWA_CoxE| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------11-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHcccEEEEEcccEEEEEc //