[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64090.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->94 1rkuA PDBj 4e-04 45.5 %
:BLT:PDB   82->166 2b0cA PDBj 3e-06 35.3 %
:RPS:PDB   5->172 2ah5A PDBj 5e-10 15.7 %
:RPS:SCOP  67->186 2hdoA1  c.108.1.6 * 1e-11 19.3 %
:HMM:SCOP  8->193 1ek1A1 c.108.1.2 * 4.7e-12 19.3 %
:HMM:PFM   67->157 PF00702 * Hydrolase 1.5e-08 28.9 90/192  
:BLT:SWISS 82->166 YIHX_SHIFL 8e-06 35.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64090.1 GT:GENE AAL64090.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1359868..1360443 GB:FROM 1359868 GB:TO 1360443 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64090.1 GB:DB_XREF GI:18160760 LENGTH 191 SQ:AASEQ MAERIDFWGVWREVVNSPVVDEVAWVVNQINSAGYEVPLRAVAQALAYKTGVESRVLAQLFIERVKARIKPAQCLGEFYSWLRERGKIAVLSNTPCKCFIEDFLREYKISVDLILTSDVLLKRKPLKQVFKYALSKLGAQPQNTILFGDGVEDLGALGLGIFTITIGVEGGHLSFPSLCHAVKWLATEFKD GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 82->166|YIHX_SHIFL|8e-06|35.3|85/199| BL:PDB:NREP 2 BL:PDB:REP 62->94|1rkuA|4e-04|45.5|33/206| BL:PDB:REP 82->166|2b0cA|3e-06|35.3|85/199| RP:PDB:NREP 1 RP:PDB:REP 5->172|2ah5A|5e-10|15.7|166/206| HM:PFM:NREP 1 HM:PFM:REP 67->157|PF00702|1.5e-08|28.9|90/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 67->186|2hdoA1|1e-11|19.3|119/207|c.108.1.6| HM:SCP:REP 8->193|1ek1A1|4.7e-12|19.3|181/0|c.108.1.2|1/1|HAD-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 95.3 SQ:SECSTR ####EEcHHHHHHHHHHHHHHHTcccccHHHHHHTcccHHHHHHTTccGGGHHHHHHHHHHHHTGGGccEEcTTHHHHHHHHHTTccEEEEEEEEHHHHHHHHHTTcGGGccEEEEEccEEccccHHHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHTcEEEEEcccccccTTcccccEEHHHG##### DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHEEEEEcccccccHHHHHHHHHHHHHHccc //