[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64109.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 56->128 HTPG_SHEAM 5e-04 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64109.1 GT:GENE AAL64109.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1381310..1382278 GB:FROM 1381310 GB:TO 1382278 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64109.1 GB:DB_XREF GI:18160781 LENGTH 322 SQ:AASEQ MVLVRVGDYEENIITVEDLEQFCRKLREELHKSECQYNSWYIRVPPERLFALLKKAYMKYAQGVLNASDVIAEFLDEYKLSRSLARTITPTLSSLGLTTAGKFTAVAIELGKLLHEGRLEEAKEKLRVLFAKNCVLKEILERAADCSELEKSVAIVLTGYGKSIRFDELKYTTELLRMAHPKCENCDMSCVTRDKIIHCIEKIIQLSAPHMRELFEKLDITLLPEHLEYVRKDGFTFSINVRGTDKIIGKILIGPPIESVHLAQLKSSLAKLDENIAEGVYEVYVKIIPILEGEEKCKSMKLLLEVVRGDLERVSKIVKISS GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 56->128|HTPG_SHEAM|5e-04|30.1|73/100| SEG 246->257|kiigkiligppi| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,34-34,101-101,104-104,109-109,157-157,165-165,199-200,202-202,207-207,221-221,291-291,297-298,300-300,305-305| PSIPRED cEEEEEccccccEEEHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHEEEEEcccccEEHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccEEcHHHHHHHHHccEEEEEEEccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //