[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64116.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:DTDA_PYRAE   RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase;         EC=3.1.-.-;

Homologs  Archaea  46/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.56.7
:251 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->199 1yqeA PDBj 2e-15 35.1 %
:RPS:SCOP  50->247 2gfqA1  c.56.7.1 * 2e-42 25.8 %
:HMM:SCOP  1->251 1yqeA1 c.56.7.1 * 7.6e-70 37.8 %
:RPS:PFM   65->247 PF04414 * tRNA_deacylase 1e-22 37.9 %
:HMM:PFM   57->248 PF04414 * tRNA_deacylase 4.7e-59 42.4 191/216  
:HMM:PFM   32->47 PF01386 * Ribosomal_L25p 0.001 37.5 16/88  
:BLT:SWISS 1->251 DTDA_PYRAE e-135 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64116.1 GT:GENE AAL64116.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1387006..1387761) GB:FROM 1387006 GB:TO 1387761 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64116.1 GB:DB_XREF GI:18160789 LENGTH 251 SQ:AASEQ MYVLVLSLGDPVSRTFLELHPMPLVETRGDIEVRKYGEIPAVVYKGEPTEFYREDILASLGKYAIFISRHEMSNPRPLFTVHTPGSWPDVSVANPRLASALFRALCKHAYEPFECAFEATHHAPNTSLVSATFIEVGSTEAEWRDKRAVGVLAQALEEALTKEFEGPTPTMAIGDLHYVTISDSVLRGEFDLGHVVPKYINITTNIVENILKKHTISIKKTIIFRKNIKNPIRTEIIELLRAKGIEVTLKG GT:EXON 1|1-251:0| SW:ID DTDA_PYRAE SW:DE RecName: Full=D-tyrosyl-tRNA(Tyr) deacylase; EC=3.1.-.-; SW:GN Name=dtdA; OrderedLocusNames=PAE2331; SW:KW Complete proteome; Hydrolase; Metal-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->251|DTDA_PYRAE|e-135|100.0|251/251| GO:SWS:NREP 2 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| SEG 210->223|ilkkhtisikktii| BL:PDB:NREP 1 BL:PDB:REP 27->199|1yqeA|2e-15|35.1|171/282| RP:PFM:NREP 1 RP:PFM:REP 65->247|PF04414|1e-22|37.9|182/216|tRNA_deacylase| HM:PFM:NREP 2 HM:PFM:REP 57->248|PF04414|4.7e-59|42.4|191/216|tRNA_deacylase| HM:PFM:REP 32->47|PF01386|0.001|37.5|16/88|Ribosomal_L25p| RP:SCP:NREP 1 RP:SCP:REP 50->247|2gfqA1|2e-42|25.8|198/274|c.56.7.1| HM:SCP:REP 1->251|1yqeA1|7.6e-70|37.8|251/0|c.56.7.1|1/1|AF0625-like| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN 11-1-11111111111-1111111----1--1---11-111111-11111-----1-1-111111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 68.1 SQ:SECSTR ##########################TccccEEEEETTEEEEEEEEEEccGGcTTHHHHHTTTcEEEEEEEcTTcccEEEEEccccccTTcccccHHHHHHHTTGGGcT##TcEEEEcccccccccccccEEEEEEEEcHHHHTcHHHHHHHHHHHHHHHHccccccEEEEEEcccTTcHHHHHHHHccEEEEEEEcGG#################################################### PSIPRED cEEEEEEcccHHHHHHHHcccccccccccEEEEEEcccEEEEEEEccccEEEccccccccccEEEEEEccccccccEEEEEEcccccHHccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccccEEEEEEcccHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccccccccEEHHHccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEcc //