[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64120.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  113/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.90.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->253 3hj9B PDBj 2e-18 36.0 %
:RPS:PDB   65->274 1bkjA PDBj 2e-24 27.6 %
:RPS:SCOP  65->274 1vfrA  d.90.1.1 * 1e-27 14.9 %
:HMM:SCOP  63->268 1bkjA_ d.90.1.1 * 1.5e-45 37.0 %
:RPS:PFM   69->252 PF00881 * Nitroreductase 3e-15 40.4 %
:HMM:PFM   70->253 PF00881 * Nitroreductase 2.5e-37 31.5 162/165  
:BLT:SWISS 63->255 Y1384_METJA 1e-34 46.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64120.1 GT:GENE AAL64120.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1391649..1392473) GB:FROM 1391649 GB:TO 1392473 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64120.1 GB:DB_XREF GI:18160793 LENGTH 274 SQ:AASEQ MIRRGFLKFLFITPLGRLISGVLSAGIFSGVIFLDVIRTDVRKRTGADVEKVLLPYPRLRGVVSVEEALANRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVYHYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTVRVYGERGRVRYVPMDLGHAGQNVYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR GT:EXON 1|1-274:0| BL:SWS:NREP 1 BL:SWS:REP 63->255|Y1384_METJA|1e-34|46.9|179/198| SEG 188->200|vrvygergrvryv| BL:PDB:NREP 1 BL:PDB:REP 42->253|3hj9B|2e-18|36.0|186/202| RP:PDB:NREP 1 RP:PDB:REP 65->274|1bkjA|2e-24|27.6|170/230| RP:PFM:NREP 1 RP:PFM:REP 69->252|PF00881|3e-15|40.4|156/157|Nitroreductase| HM:PFM:NREP 1 HM:PFM:REP 70->253|PF00881|2.5e-37|31.5|162/165|Nitroreductase| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00881|IPR000415| RP:SCP:NREP 1 RP:SCP:REP 65->274|1vfrA|1e-27|14.9|195/217|d.90.1.1| HM:SCP:REP 63->268|1bkjA_|1.5e-45|37.0|165/239|d.90.1.1|1/1|FMN-dependent nitroreductase-like| OP:NHOMO 168 OP:NHOMOORG 144 OP:PATTERN 111-11-1--------1-111111----------111------22-22--111123--212-1-1--- -------------1----------------------------1----1-12------1------2--------------------1--111--1-------------------------------11-111--1-1----1111--1112111----------1-111112-----------------111-11-------1--------------1--------------1---------------------------------------------------111--------------------------------------11-1111---------------1--------2-----1-2------------------------------------------------1-----1----------------------1--1------------------------------------------------------------1--1--1111111121111-1-1--22---11--------11--1----------------------111-11--2---1----212-11-----211-------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------1-1-11-----------------------------------------------------11-11-1-----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 85.0 SQ:SECSTR #########################################EEcccccccEEEcccccccccHHHHHHHHTcccccccccccccHHHHHHHHHHHTcEEETTTTEHTcccGGGcccEEEEEcccHHHHHHTTHccTTHHHHHHHccEEEEEEETEHHHHHHHHHTTccTHHHHccEEEEEEEEcHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHTTcEEEEEGGGGHHHHHHHTTccTTEEEEEEEEEEcccccccccHHHHccccccccc DISOP:02AL 1-2, 273-274| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHcccccHHHHHHHcccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHcccEEEEEEEccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHccc //