Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64125.1
DDBJ      :             hypothetical protein

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:HMM:PFM   124->153 PF09671 * Spore_GerQ 2.7e-05 46.2 26/81  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64125.1 GT:GENE AAL64125.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1394791..1395426) GB:FROM 1394791 GB:TO 1395426 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64125.1 GB:DB_XREF GI:18160798 LENGTH 211 SQ:AASEQ MVCLDPFTPDEFTIWYRHLGRLRLFWAKPLVELLPLYKIPEGCVIKVRWASERPRLEEAYIAILKKIRKLDFLVPLRGTKILLTPHVIEKDLYQQRGALYIYSTSRPCASGIHIEKPTEGHPEPGPDHIVISSDASGHKYLVYLNKWNFNIDYLWIASEEYIDEAVESAICETRRLGGRYTSVATGEGHLSSINFDLYKPDYLYNTYKLAF GT:EXON 1|1-211:0| HM:PFM:NREP 1 HM:PFM:REP 124->153|PF09671|2.7e-05|46.2|26/81|Spore_GerQ| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 119-121| PSIPRED cEEccccccccEEHHHHHHccEEEEHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHHEEEEccccEEEEEcHHHHHHHHHHcccEEEEEcccccccccEEcccccccccccccEEEEEccccccEEEEEEEEcccEEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEEEEccccEEEEEEEEc //