[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64158.1
DDBJ      :             hypothetical protein
Swiss-Prot:SECG_PYRAE   RecName: Full=Preprotein translocase subunit secG;AltName: Full=Protein transport protein Sec61 subunit beta homolog;

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->54 PF03911 * Sec61_beta 6.4e-13 41.0 39/41  
:BLT:SWISS 1->35 SECG_PYRAE 9e-16 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64158.1 GT:GENE AAL64158.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1420061..1420237 GB:FROM 1420061 GB:TO 1420237 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64158.1 GB:DB_XREF GI:18160833 LENGTH 58 SQ:AASEQ MARRRKYEGLNPFVAAGLIKFSEEGELEKIKLTPRAAVVISLAIIGLLIAINLLLPPL GT:EXON 1|1-58:0| SW:ID SECG_PYRAE SW:DE RecName: Full=Preprotein translocase subunit secG;AltName: Full=Protein transport protein Sec61 subunit beta homolog; SW:GN Name=secG; OrderedLocusNames=PAE2389; SW:KW Cell membrane; Complete proteome; Membrane; Protein transport;Translocation; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->35|SECG_PYRAE|9e-16|100.0|35/58| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0055085|"GO:transmembrane transport"|Translocation| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 34->56| SEG 36->57|aavvislaiiglliainlllpp| HM:PFM:NREP 1 HM:PFM:REP 15->54|PF03911|6.4e-13|41.0|39/41|Sec61_beta| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED cccccccccccHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccc //