[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64163.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:198 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->104 PF06177 * QueT 0.00087 20.0 55/152  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64163.1 GT:GENE AAL64163.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1425023..1425619 GB:FROM 1425023 GB:TO 1425619 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64163.1 GB:DB_XREF GI:18160839 LENGTH 198 SQ:AASEQ MQQTINRVKSWLGEGWEFYWGLPPSGVYLLKEEYMVDPRTLDVKCGGGDGLVIVYVVASFGSVNVVYGKVKPFITRCPTATFTRSFKRDMIKSAVKLLIEFATTADGVSIFQINPEVVRFAGLCEEYPLVCDEPAAVVKKLEERIARAPGPKRAVGSTGWALGELVRVLNDVVSRDPTFIEVIKKVAEDPERLRACYV GT:EXON 1|1-198:0| TM:NTM 1 TM:REGION 46->68| HM:PFM:NREP 1 HM:PFM:REP 50->104|PF06177|0.00087|20.0|55/152|QueT| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHccccEEEEccccccEEEEEHHHcccccEEEEEEcccccEEEEEEEcccccEEEEEEcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHccc //