[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64165.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->55 3bfvA PDBj 6e-05 42.3 %
:RPS:PDB   7->200 3cwqB PDBj 1e-09 16.2 %
:RPS:SCOP  7->226 1cp2A  c.37.1.10 * 1e-07 14.1 %
:HMM:SCOP  5->233 1ionA_ c.37.1.10 * 2.1e-15 23.4 %
:HMM:PFM   7->139 PF01656 * CbiA 4.2e-11 35.8 106/194  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64165.1 GT:GENE AAL64165.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1425908..1426612 GB:FROM 1425908 GB:TO 1426612 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64165.1 GB:DB_XREF GI:18160841 LENGTH 234 SQ:AASEQ MRGVKTVIVTSLDGGVGKTTIASVLAVKKGFTLLVDMDWEKADLSQLFRVPKKPGWVAPYLKGGMPYVHRVSPLLYVMPGYEAYELYQRFGDDVVGDFEEAVLEWAENMPKFVAKLRIPVDTVIIDTTAALRVEVLSKLQQLGTYNIFMADRRLISRISDIKAEQYRRYMAYSSLVVVNQLEKDEMKIARKITPVAIKRVAIRDYYGESIANSILRDRENRKSIDHILTRIKSV GT:EXON 1|1-234:0| BL:PDB:NREP 1 BL:PDB:REP 4->55|3bfvA|6e-05|42.3|52/241| RP:PDB:NREP 1 RP:PDB:REP 7->200|3cwqB|1e-09|16.2|179/195| HM:PFM:NREP 1 HM:PFM:REP 7->139|PF01656|4.2e-11|35.8|106/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 7->226|1cp2A|1e-07|14.1|206/269|c.37.1.10| HM:SCP:REP 5->233|1ionA_|2.1e-15|23.4|209/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN ------------------11121--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 98.7 SQ:SECSTR ccccEEEEEEEccccccHHHHHHHHHHHHccEEEEEEcTTcHHHHHHHTcccccEEEEGGGHHHHEEEEEEcccHHHHHHTccEEEEEEcccHHHHHHHHHHHccHHTHHHHHTTcGGGEEEEEcccccTTccHHHHHHHGGccEEEEHHHHTTcccccccccccHHHHHHHHHTccGGGcccTHHHHHHHHHHHHHHHHHHHHHHTccEEEEEcccHHHHHHHHHcGGGc### DISOP:02AL 1-3| PSIPRED ccccEEEEEEEccccccHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccccHHHHccccHHHHHcccEEEccccHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHHHHcccHHHEEEccHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcc //