[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64179.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->78 PF11773 * PulG 0.00016 21.9 64/82  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64179.1 GT:GENE AAL64179.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1438245..1438538 GB:FROM 1438245 GB:TO 1438538 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64179.1 GB:DB_XREF GI:18160856 LENGTH 97 SQ:AASEQ MIEEYIELAAVTALAVIAITAFAYIFAYITTPAACQAVRLAAENPGSELVAYGRLRVITNDTHVSLCGITIEKDKILIYRTEGYLFIVSDNYKIYIK GT:EXON 1|1-97:0| TM:NTM 1 TM:REGION 8->30| SEG 8->31|laavtalaviaitafayifayitt| HM:PFM:NREP 1 HM:PFM:REP 15->78|PF11773|0.00016|21.9|64/82|PulG| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEccEEEEEEEccEEEEEEccEEEEEc //