[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64186.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  39/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:411 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   216->333 1oltA PDBj 6e-05 29.9 %
:RPS:PDB   224->382 3ebjC PDBj 1e-17 8.6 %
:RPS:SCOP  146->364 1oltA  c.1.28.2 * 5e-18 26.2 %
:HMM:SCOP  135->392 1oltA_ c.1.28.2 * 7.8e-43 32.0 %
:RPS:PFM   268->322 PF04055 * Radical_SAM 2e-06 38.2 %
:HMM:PFM   157->328 PF04055 * Radical_SAM 4e-25 33.5 155/166  
:HMM:PFM   51->109 PF02310 * B12-binding 8.9e-10 39.0 59/121  
:BLT:SWISS 32->390 Y1487_METJA 7e-43 35.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64186.1 GT:GENE AAL64186.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1445776..1447011 GB:FROM 1445776 GB:TO 1447011 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64186.1 GB:DB_XREF GI:18160863 LENGTH 411 SQ:AASEQ MILLARVFEGPNNGLAYAVAPVEDKYKIIPTKDPLLDAANLYAKGEKVLILYSLSTPLFVEIWRELIAVAGRFPVVAGGPHAAGDPITLLKLGVKYVVVGDGEVALPAIIEKEEGLSDETPPNVLIMEDGKVKAGRRVYTELVYKTYSEALGAYPPIEIMRSCGYRCAFCQTWAQGPVRYRPLEKVEEMVKVYVKKGRREIRFIAPVGFLYQSKDGKTPNIDALISLLKTVREAGGLPFLGTFPSETRPETVTRDVLSALKNLLANKRLSFGLQTASERLLKLAKRGHDVATVEEAVVTARAFGFTPVVDIIAGLPGEDEEDVVATVKTMERLAAMGARIRMHYFIPLPGTPLWGREPSPPHKLYTEFAKRYRKKVEGYWEEQIQLSRRIIETYRQISGYLSRTTPISKAS GT:EXON 1|1-411:0| BL:SWS:NREP 1 BL:SWS:REP 32->390|Y1487_METJA|7e-43|35.2|355/426| SEG 89->100|llklgvkyvvvg| SEG 184->196|ekveemvkvyvkk| SEG 290->302|vatveeavvtara| BL:PDB:NREP 1 BL:PDB:REP 216->333|1oltA|6e-05|29.9|117/434| RP:PDB:NREP 1 RP:PDB:REP 224->382|3ebjC|1e-17|8.6|152/176| RP:PFM:NREP 1 RP:PFM:REP 268->322|PF04055|2e-06|38.2|55/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 157->328|PF04055|4e-25|33.5|155/166|Radical_SAM| HM:PFM:REP 51->109|PF02310|8.9e-10|39.0|59/121|B12-binding| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 146->364|1oltA|5e-18|26.2|206/436|c.1.28.2| HM:SCP:REP 135->392|1oltA_|7.8e-43|32.0|244/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 56 OP:NHOMOORG 54 OP:PATTERN 111111------------11111-----------111111111111121111111111111----1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 341 STR:RPRED 83.0 SQ:SECSTR ###############################################################HHHHTTccccccEEcccEETTEEccccEEEcccTTcccEEEEEEEEEEEEEEEEcccEEETTEEEcHHTccEEEEEETTTccEETEEcEEEccccccccccEEEEEEEEETEEEEEEEEEEccEEEccEEEEEEEEcccccEEEEcccEEEccTTccccccccHHHHHHHHccHHHHccHHHHHHHHTTTccTTTcHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHTTcccccTTEEEEEEEEcccHHHHHHHHHHHHccTTETEcccEEEEEETTccEEEGGGcccccHHHHHHHHHHHHHHHHHHHHTEEEEEccccEEEEETTEEEEEc####### DISOP:02AL 403-411| PSIPRED cEEEEEEEcccccEEEEEEccHHHHHHHHHcccccccHHHHHcccccEEEEEEEEHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHccccEEEEcccHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEccEEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHcccccEEEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccc //