[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64191.1
DDBJ      :             ribosomal protein S24
Swiss-Prot:RS24_PYRAE   RecName: Full=30S ribosomal protein S24e;

Homologs  Archaea  16/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.12.1
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->90 1xn9A PDBj 1e-08 35.4 %
:RPS:SCOP  6->91 2g1dA1  d.12.1.3 * 9e-22 29.1 %
:HMM:SCOP  4->105 1xn9A_ d.12.1.3 * 2.1e-25 37.6 %
:RPS:PFM   22->90 PF01282 * Ribosomal_S24e 1e-08 33.3 %
:HMM:PFM   23->100 PF01282 * Ribosomal_S24e 2e-25 41.0 78/84  
:BLT:SWISS 1->91 RS24_PYRAE 3e-47 100.0 %
:PROS 63->85|PS00529|RIBOSOMAL_S24E
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64191.1 GT:GENE AAL64191.1 GT:PRODUCT ribosomal protein S24 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1448834..1449199) GB:FROM 1448834 GB:TO 1449199 GB:DIRECTION - GB:PRODUCT ribosomal protein S24 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL64191.1 GB:DB_XREF GI:18160868 LENGTH 121 SQ:AASEQ MSAESFNIVHIRENKLLARRELLVEAVHQNASTPTRQSVREWVAKQLGIDISNVFVRRIKTEFGRGRSLAEVHVYNDSKIARVIEPLYILARNLGEEGKKLLEEAKKRRNERREKKKRKKK GT:EXON 1|1-121:0| SW:ID RS24_PYRAE SW:DE RecName: Full=30S ribosomal protein S24e; SW:GN Name=rps24e; OrderedLocusNames=PAE2434; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|RS24_PYRAE|3e-47|100.0|91/121| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 63->85|PS00529|RIBOSOMAL_S24E|PDOC00458| SEG 92->120|rnlgeegkklleeakkrrnerrekkkrkk| BL:PDB:NREP 1 BL:PDB:REP 8->90|1xn9A|1e-08|35.4|82/101| RP:PFM:NREP 1 RP:PFM:REP 22->90|PF01282|1e-08|33.3|69/83|Ribosomal_S24e| HM:PFM:NREP 1 HM:PFM:REP 23->100|PF01282|2e-25|41.0|78/84|Ribosomal_S24e| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01282|IPR001976| GO:PFM GO:0005622|"GO:intracellular"|PF01282|IPR001976| GO:PFM GO:0005840|"GO:ribosome"|PF01282|IPR001976| GO:PFM GO:0006412|"GO:translation"|PF01282|IPR001976| RP:SCP:NREP 1 RP:SCP:REP 6->91|2g1dA1|9e-22|29.1|86/98|d.12.1.3| HM:SCP:REP 4->105|1xn9A_|2.1e-25|37.6|101/0|d.12.1.3|1/1|Ribosomal proteins S24e, L23 and L15e| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN 111-111----1--1-1111111-----------------------------------------1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 71.9 SQ:SECSTR ###cEEEEEEEEEETTTTEEEEEEEEEEcccccccHHHHHHHHHHHTTccTTTEEEEEEEEcccccEEEEEEEEcccHHHHHHHHTGGGc############################### DISOP:02AL 100-121| PSIPRED cccEEEEEEEEEcccccccEEEEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEEEEEccHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHcccc //