[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64219.1
DDBJ      :             conserved protein associated with acetyl-CoA C-acyltransferase
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:114 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->58 2gnrB PDBj 2e-04 32.1 %
:RPS:SCOP  5->101 2gnrA1  b.40.4.15 * 1e-10 22.7 %
:RPS:PFM   7->42 PF12172 * DUF35_N 2e-06 51.4 %
:HMM:PFM   7->39 PF12172 * DUF35_N 8.2e-12 45.5 33/37  
:HMM:PFM   43->97 PF01796 * DUF35 9.2e-12 30.9 55/68  
:BLT:SWISS 14->85 Y1552_METJA 2e-10 47.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64219.1 GT:GENE AAL64219.1 GT:PRODUCT conserved protein associated with acetyl-CoA C-acyltransferase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1474099..1474443 GB:FROM 1474099 GB:TO 1474443 GB:DIRECTION + GB:PRODUCT conserved protein associated with acetyl-CoA C-acyltransferase GB:NOTE Fatty acid and phospholipid metabolism; Degradation GB:PROTEIN_ID AAL64219.1 GB:DB_XREF GI:18160899 LENGTH 114 SQ:AASEQ MTLLLFKALNENRLVGSICKKCGYAHFPPLEKCPKCRGENEIVDVSKHGVVLTYSEVYVSNGIFETPYTVAIAQFGAFKIPGRVVSKVNIGDPVQWEIIEIKRSPGRWYIFKRI GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 14->85|Y1552_METJA|2e-10|47.9|71/141| BL:PDB:NREP 1 BL:PDB:REP 6->58|2gnrB|2e-04|32.1|53/133| RP:PFM:NREP 1 RP:PFM:REP 7->42|PF12172|2e-06|51.4|35/36|DUF35_N| HM:PFM:NREP 2 HM:PFM:REP 7->39|PF12172|8.2e-12|45.5|33/37|DUF35_N| HM:PFM:REP 43->97|PF01796|9.2e-12|30.9|55/68|DUF35| RP:SCP:NREP 1 RP:SCP:REP 5->101|2gnrA1|1e-10|22.7|97/137|b.40.4.15| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN ------1-1111111---1----2-----------1------1----------1--------1----- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 46.5 SQ:SECSTR #####HHHHHTTcEEEEEcTTTccEEcccccccTTTcccEEEEEcGGGcEEEEEEEEE######################################################## PSIPRED ccHHHHHHHHHccEEEEEEccccEEEEcccccccccccccEEEEccccEEEEEEEEEEcccccccccEEEEEEEEcccEEEEEEccccccccEEEEEEEEEEEccccEEEEEEc //