[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64265.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  27/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.37.1
:360 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   33->354 2fnaA PDBj 1e-58 42.9 %
:RPS:PDB   121->244 1eaqA PDBj 3e-04 2.6 %
:RPS:SCOP  33->284 2fnaA2  c.37.1.20 * 7e-55 44.0 %
:HMM:SCOP  1->285 2fnaA2 c.37.1.20 * 8e-47 33.0 %
:HMM:SCOP  284->356 2fnaA1 a.4.5.11 * 5e-21 46.6 %
:RPS:PFM   31->225 PF01637 * Arch_ATPase 6e-10 37.9 %
:HMM:PFM   14->252 PF01637 * Arch_ATPase 4.2e-35 27.1 225/234  
:HMM:PFM   277->341 PF07900 * DUF1670 0.0007 16.9 65/220  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64265.1 GT:GENE AAL64265.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1515109..1516191) GB:FROM 1515109 GB:TO 1516191 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64265.1 GB:DB_XREF GI:18160949 LENGTH 360 SQ:AASEQ MLFRDRPAERLEELFDREEEVRRLLNAVNSSALTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRYISYGDLLEALRKELRRLLPLHKRLGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERLVLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPFSRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFCNFVQYMGSQRYIHVAKVCKNGARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPVLRTALQSLRC GT:EXON 1|1-360:0| SEG 9->25|erleelfdreeevrrll| SEG 76->94|llealrkelrrllplhkrl| BL:PDB:NREP 1 BL:PDB:REP 33->354|2fnaA|1e-58|42.9|308/347| RP:PDB:NREP 1 RP:PDB:REP 121->244|1eaqA|3e-04|2.6|114/121| RP:PFM:NREP 1 RP:PFM:REP 31->225|PF01637|6e-10|37.9|169/208|Arch_ATPase| HM:PFM:NREP 2 HM:PFM:REP 14->252|PF01637|4.2e-35|27.1|225/234|Arch_ATPase| HM:PFM:REP 277->341|PF07900|0.0007|16.9|65/220|DUF1670| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01637|IPR011579| RP:SCP:NREP 1 RP:SCP:REP 33->284|2fnaA2|7e-55|44.0|243/278|c.37.1.20| HM:SCP:REP 1->285|2fnaA2|8e-47|33.0|279/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 284->356|2fnaA1|5e-21|46.6|73/0|a.4.5.11|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 80 OP:NHOMOORG 33 OP:PATTERN --1---14333444512322111-------------------------------91341132--5--- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 90.0 SQ:SECSTR ################################EEEEEEcTTccHHHHHHHHHHHHHTEEEEGGGGTTcccccHHHHHHHHHHHHHHHHHHcTTHHHHTTTcTTEHEEcccEEETccGccccHHHHHHcTTTcEEcccTTEEEcccccEEETTcTTcccHHHHcccccccEEEEcccccTTcEEEEEEETTEEEEcccEEEETTEEEccccEEcccccTTcccEEEEEEcccccEEEEcccccEEcHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHTTccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHTTcEEEccccEEEccHHHHHHHT#### PSIPRED ccccccccccHHHcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHcccccHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccccccccccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHHHccc //