[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64281.1
DDBJ      :             adenylylsulfate reductase beta subunit part 2, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->72 1jnrB PDBj 1e-09 49.2 %
:RPS:SCOP  11->72 1jnrB  d.58.1.5 * 2e-14 48.3 %
:RPS:PFM   10->65 PF12139 * APS-reductase_C 3e-06 51.8 %
:HMM:PFM   2->58 PF12139 * APS-reductase_C 4.2e-21 50.9 55/84  
:HMM:PFM   39->82 PF07961 * MBA1 0.00079 22.7 44/235  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64281.1 GT:GENE AAL64281.1 GT:PRODUCT adenylylsulfate reductase beta subunit part 2, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1528762..1529034 GB:FROM 1528762 GB:TO 1529034 GB:DIRECTION + GB:PRODUCT adenylylsulfate reductase beta subunit part 2, authentic frameshift GB:NOTE Central intermediary metabolism; Sulfur metabolism GB:PROTEIN_ID AAL64281.1 GB:DB_XREF GI:18160966 LENGTH 90 SQ:AASEQ MVRDTKKNIIYWRIVYRDGTVYDFASPIRTTPWGSAKGALDYPERQDLDSELLALEDKPEYLGFPELPRPKQAVRIVGSLLKAKQQSGGR GT:EXON 1|1-90:0| BL:PDB:NREP 1 BL:PDB:REP 10->72|1jnrB|1e-09|49.2|61/149| RP:PFM:NREP 1 RP:PFM:REP 10->65|PF12139|3e-06|51.8|56/80|APS-reductase_C| HM:PFM:NREP 2 HM:PFM:REP 2->58|PF12139|4.2e-21|50.9|55/84|APS-reductase_C| HM:PFM:REP 39->82|PF07961|0.00079|22.7|44/235|MBA1| RP:SCP:NREP 1 RP:SCP:REP 11->72|1jnrB|2e-14|48.3|60/149|d.58.1.5| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 67.8 SQ:SECSTR #########EEEEEEcTTccEEEEEEEcccccTTcccTTTTcccHHHHTccccTTT##TGGGcccccccccc################## DISOP:02AL 1-4, 85-90| PSIPRED ccccccccEEEEEEEEccccEEEccccccccccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccc //