[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64282.1
DDBJ      :             adenylylsulfate reductase alpha subunit part 1, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  92/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.168.1
:462 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->460 2fjbA PDBj e-118 50.7 %
:RPS:PDB   39->443 1d4cB PDBj 6e-28 18.5 %
:RPS:SCOP  6->270 1jnrA2  c.3.1.4 * 2e-32 45.5 %
:RPS:SCOP  242->379 1jnrA3  d.168.1.1 * 1e-16 39.6 %
:RPS:SCOP  390->461 1jnrA2  c.3.1.4 * 2e-13 51.4 %
:HMM:SCOP  1->453 1jnrA2 c.3.1.4 * 3.3e-65 29.4 %
:RPS:PFM   75->418 PF00890 * FAD_binding_2 1e-15 28.8 %
:HMM:PFM   13->240 PF00890 * FAD_binding_2 7.4e-13 22.8 219/421  
:BLT:SWISS 57->447 NADB2_RALSO 6e-06 28.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64282.1 GT:GENE AAL64282.1 GT:PRODUCT adenylylsulfate reductase alpha subunit part 1, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1529036..1530424 GB:FROM 1529036 GB:TO 1530424 GB:DIRECTION + GB:PRODUCT adenylylsulfate reductase alpha subunit part 1, authentic frameshift GB:NOTE Central intermediary metabolism; Sulfur metabolism GB:PROTEIN_ID AAL64282.1 GB:DB_XREF GI:18160967 LENGTH 462 SQ:AASEQ MSLHFPTKIVDTDILVVGGGMAGCGAVFEAKYWCRGRCKVTLVDKANTEKSGAVGMGLSACNLGVFTTDPDDPKPEDFVQYVRNDLLGVVREDLIYDIARHMTSTIKLFDEWGLPIWRDPKTGKYLRTGRWQHPIHGESYKAIIAEACRKSADEVYERVFVTHPLLDESRPNRIAGVVGFHVRDGTFYVFRAKAVIVAAGGTSLLYRPRSVGEGLGRAWYPTWASGSAYAIPILAGAETVNFEFRLVVVRFKDAYGPVGFPYLLLKMRSTDVKGKQWEPLPDEAKAELAKIFYDFAWARPTPTPIRTWVTIQNLKEGRGPDLMQTQERLPDEESLKVLFEDYLDMTPTQVFLWASQNIHPQKTPSELMPTEPYVQASHASSGGMWASGPPDIAPEEYKWGPNRMLTVEGLFGAGDVVGASGHKFSSGSFTEGRIAGKAAVRYVLTQAKDYKPTISNDTIERY GT:EXON 1|1-462:0| BL:SWS:NREP 1 BL:SWS:REP 57->447|NADB2_RALSO|6e-06|28.6|322/536| SEG 16->27|vvgggmagcgav| BL:PDB:NREP 1 BL:PDB:REP 6->460|2fjbA|e-118|50.7|448/642| RP:PDB:NREP 1 RP:PDB:REP 39->443|1d4cB|6e-28|18.5|390/566| RP:PFM:NREP 1 RP:PFM:REP 75->418|PF00890|1e-15|28.8|295/375|FAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 13->240|PF00890|7.4e-13|22.8|219/421|FAD_binding_2| GO:PFM:NREP 2 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00890|IPR003953| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00890|IPR003953| RP:SCP:NREP 3 RP:SCP:REP 6->270|1jnrA2|2e-32|45.5|264/356|c.3.1.4| RP:SCP:REP 242->379|1jnrA3|1e-16|39.6|134/145|d.168.1.1| RP:SCP:REP 390->461|1jnrA2|2e-13|51.4|70/356|c.3.1.4| HM:SCP:REP 1->453|1jnrA2|3.3e-65|29.4|310/357|c.3.1.4|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 107 OP:NHOMOORG 97 OP:PATTERN -----------------1111--1-------------------------------------------- ----1----------11-------------------1-11---------------------------1----------------------------------------------------------11--1--1---------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------11-11------------22----1-----11-311111-1-1----1--1-1------------1-1-1----1-------------21-11-11-1---------------1--------------------------1-------------------------------1----------111111-----11--------1--1-1---11---------------2-------------------1111111121222---------------1-1---------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------11111------111-11-1--1--1------------------------------------------11--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 453 STR:RPRED 98.1 SQ:SECSTR #####cEEEEEccEEEEcccHHHHHHHHHccccccccHcEEEEcccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHTTccccEEEccTTccccccEEEccccccHHHHHHHHHHHTTcEEEccEEEEEEEEccccTccEEEEEEEETTTTEEEEEEccEEEEcccccTTcHHHHHHHcGGGTTcEEcccTTcccHHHHHHTccEEcTTcEEEEEEEcTTTccEEcccTHHHHTTcEEEcccccccccTTccHHHHHHHHHTcTTccEEEEEEHHHHHHcTHHHHHHHTTccEEEccHHHHHHHHTccHHHHHHHHccccccccccccccEEEEEEEEcEEEEEEEccEEEEccEEcccTTcEEEcTTTccEEEEEEEccTTEEcccTTcccTHHHHHHHHHHHHHHHHHHHccc##ccccHHHHH## DISOP:02AL 1-4, 447-456, 458-459| PSIPRED ccccccEEEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHcccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEEEEEEEcccccEEEEEEEEEEcccEEEEEEEcEEEEEcccccccccccccccccccccccccccHHHHHHHHHccccEEcccEEEEccEEEccccccEEcccccEEEEEEcccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccEEEEcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccEEccccEEEcccccEEcccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccc //