[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64311.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.3
:83 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->56 1je3A PDBj 4e-10 52.3 %
:RPS:PDB   13->59 1dcjA PDBj 7e-11 27.7 %
:RPS:SCOP  13->57 1pavA  d.68.3.3 * 3e-11 28.9 %
:HMM:SCOP  12->83 1je3A_ d.68.3.3 * 3.4e-19 45.1 %
:RPS:PFM   15->59 PF01206 * SirA 3e-09 55.6 %
:HMM:PFM   14->82 PF01206 * SirA 2.4e-23 48.5 68/70  
:BLT:SWISS 13->56 YEDF_SHIFL 1e-09 52.3 %
:PROS 15->39|PS01148|UPF0033
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64311.1 GT:GENE AAL64311.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1550445..1550696 GB:FROM 1550445 GB:TO 1550696 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64311.1 GB:DB_XREF GI:18160998 LENGTH 83 SQ:AASEQ MSEAVLDEVRRVYVLDLRGYVCPYPQLATVRAMRKLPKGSVLEVITDNPPSCENVPAVARREGGLVEGVYEVERGVWKIVIRV GT:EXON 1|1-83:0| BL:SWS:NREP 1 BL:SWS:REP 13->56|YEDF_SHIFL|1e-09|52.3|44/77| PROS 15->39|PS01148|UPF0033|PDOC00884| SEG 60->76|rregglvegvyevergv| BL:PDB:NREP 1 BL:PDB:REP 13->56|1je3A|4e-10|52.3|44/97| RP:PDB:NREP 1 RP:PDB:REP 13->59|1dcjA|7e-11|27.7|47/81| RP:PFM:NREP 1 RP:PFM:REP 15->59|PF01206|3e-09|55.6|45/70|SirA| HM:PFM:NREP 1 HM:PFM:REP 14->82|PF01206|2.4e-23|48.5|68/70|SirA| GO:PFM:NREP 4 GO:PFM GO:0005515|"GO:protein binding"|PF01206|IPR001455| GO:PFM GO:0005737|"GO:cytoplasm"|PF01206|IPR001455| GO:PFM GO:0008033|"GO:tRNA processing"|PF01206|IPR001455| GO:PFM GO:0016783|"GO:sulfurtransferase activity"|PF01206|IPR001455| RP:SCP:NREP 1 RP:SCP:REP 13->57|1pavA|3e-11|28.9|45/78|d.68.3.3| HM:SCP:REP 12->83|1je3A_|3.4e-19|45.1|71/97|d.68.3.3|1/1|SirA-like| OP:NHOMO 7 OP:NHOMOORG 4 OP:PATTERN -----------------2212----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 85.5 SQ:SECSTR ############EEEccTTccTTHHHHHHHHHHHHccTTccEEEEEccTTHHHHHHHHHHHccccEEEEEEcccccEEEEEEc DISOP:02AL 1-4| PSIPRED ccccccccccccEEEEcccccccHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHcccEEEEEEEccccEEEEEEEc //