[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64313.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.114.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->122 2d1pB PDBj 4e-08 17.7 %
:RPS:SCOP  2->122 2d1pB1  c.114.1.1 * 3e-08 17.7 %
:HMM:SCOP  1->122 2d1pA1 c.114.1.1 * 9.3e-15 36.5 %
:HMM:PFM   18->110 PF02635 * DrsE 7e-08 30.4 79/119  
:BLT:SWISS 1->122 Y989_METJA 2e-05 33.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64313.1 GT:GENE AAL64313.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1552396..1552764 GB:FROM 1552396 GB:TO 1552764 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL64313.1 GB:DB_XREF GI:18161000 LENGTH 122 SQ:AASEQ MKIGVIIASDDPMRLYVAATYIATEVARGNEVGVFVTGRGVVPFSKGDLSDYPEAVKMREMKVTWLEIFKAAKPLGVKVAVCETAAKIYGLTAQDFRHLEIVDEISSMYSFLEEYGEKIVTF GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 1->122|Y989_METJA|2e-05|33.0|112/114| RP:PDB:NREP 1 RP:PDB:REP 2->122|2d1pB|4e-08|17.7|113/119| HM:PFM:NREP 1 HM:PFM:REP 18->110|PF02635|7e-08|30.4|79/119|DrsE| RP:SCP:NREP 1 RP:SCP:REP 2->122|2d1pB1|3e-08|17.7|113/119|c.114.1.1| HM:SCP:REP 1->122|2d1pA1|9.3e-15|36.5|115/0|c.114.1.1|1/1|DsrEFH-like| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN ---------11-------212----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 99.2 SQ:SECSTR ccEEEEEccTTcTHHHHHHHHHHHHHTTcccEEEEEcGGGGGGGcTTcccccGGGGTccccGGGGHHHHHTTHHHcccEEEEHHHHHHTTccTTcH#ccccccEEEcHHHHHHHHTTEEEEc DISOP:02AL 54-55| PSIPRED cEEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHccc //