[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64343.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.3
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  23->79 1je3A_ d.68.3.3 * 6.2e-05 24.6 %
:HMM:PFM   23->77 PF01206 * SirA 2.8e-07 25.5 55/70  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64343.1 GT:GENE AAL64343.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 1578062..1578307 GB:FROM 1578062 GB:TO 1578307 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64343.1 GB:DB_XREF GI:18161032 LENGTH 81 SQ:AASEQ MDIVATYQFSKDDSCHKLGLKHPVYTVLEKLKQLAPGQGIEVITDDFDWALTMEIIAKGANYGVIRESRGGLARVVIYRLQ GT:EXON 1|1-81:0| HM:PFM:NREP 1 HM:PFM:REP 23->77|PF01206|2.8e-07|25.5|55/70|SirA| HM:SCP:REP 23->79|1je3A_|6.2e-05|24.6|57/97|d.68.3.3|1/1|SirA-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 45-46,48-48,53-54,59-60,62-62,67-67,73-73| PSIPRED ccEEEEEEEcccccHHHHcccccHHHHHHHHHHccccccEEEEEEcccEEEEEEEEEccccccEEEEccccEEEEEEEEEc //