[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64352.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->110 1biaA PDBj 2e-07 7.6 %
:RPS:SCOP  2->129 1yg2A  a.4.5.61 * 1e-08 17.7 %
:HMM:SCOP  2->119 1yg2A_ a.4.5.61 * 4.7e-08 29.9 %
:HMM:PFM   7->50 PF01978 * TrmB 2.5e-09 40.9 44/68  
:BLT:SWISS 6->66 HRCA_ONYPE 5e-04 34.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64352.1 GT:GENE AAL64352.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1587468..1588004) GB:FROM 1587468 GB:TO 1588004 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL64352.1 GB:DB_XREF GI:18161042 LENGTH 178 SQ:AASEQ MSSRHSVLEAVLMLGRAKAYELAKALPYSVSTVYYALYRLEAEGFVEADRDYYVPTFKGVLYYVSYKGCNFIATNATRRLINRHYASELNDREICDALEFLSKRMPHSRHILPALLEAVSGAKLSDLPPSVKRLLATAMAEAGGPIDNVHIGVLIGNIFAGYCKMCSLVVAPCRSIKL GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 6->66|HRCA_ONYPE|5e-04|34.4|61/100| TM:NTM 1 TM:REGION 152->174| RP:PDB:NREP 1 RP:PDB:REP 4->110|1biaA|2e-07|7.6|105/292| HM:PFM:NREP 1 HM:PFM:REP 7->50|PF01978|2.5e-09|40.9|44/68|TrmB| RP:SCP:NREP 1 RP:SCP:REP 2->129|1yg2A|1e-08|17.7|124/169|a.4.5.61| HM:SCP:REP 2->119|1yg2A_|4.7e-08|29.9|117/0|a.4.5.61|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------11-11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 67.4 SQ:SECSTR ###HHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETEEEcccccccccHHHHHHTcccccEEEcHHcccccHHHHHHTTGGGccTTcEEEEcccTHHHHHHHTcccEE####################################################### DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccEEcccccccHHHHHHEEEEEEccccEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //