[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL64363.1
DDBJ      :             transcriptional regulator, conjectural
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:94 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->89 3ctaA PDBj 4e-06 40.4 %
:RPS:PDB   47->90 2co5B PDBj 3e-06 18.2 %
:RPS:SCOP  47->90 2co5A1  a.4.5.48 * 5e-07 18.2 %
:HMM:SCOP  6->90 2fbkA1 a.4.5.28 * 7.8e-10 43.5 %
:HMM:PFM   43->74 PF01047 * MarR 6.4e-10 46.9 32/59  
:HMM:PFM   61->89 PF11313 * DUF3116 0.00095 31.0 29/85  
:BLT:SWISS 43->89 RIFK_THEAC 1e-05 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL64363.1 GT:GENE AAL64363.1 GT:PRODUCT transcriptional regulator, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(1594344..1594628) GB:FROM 1594344 GB:TO 1594628 GB:DIRECTION - GB:PRODUCT transcriptional regulator, conjectural GB:NOTE Cellular processes; Toxin production and resistance GB:PROTEIN_ID AAL64363.1 GB:DB_XREF GI:18161054 LENGTH 94 SQ:AASEQ MISDVLDRLLRAYRHMLIEKAVSMGLTELQLSALLAAAEGVNTVVKLADRLMVAQPTATDTLLALEKKGFITRHRVGKTTVIKLTEKGVKPSRR GT:EXON 1|1-94:0| BL:SWS:NREP 1 BL:SWS:REP 43->89|RIFK_THEAC|1e-05|40.4|47/220| SEG 29->38|lqlsallaaa| BL:PDB:NREP 1 BL:PDB:REP 43->89|3ctaA|4e-06|40.4|47/187| RP:PDB:NREP 1 RP:PDB:REP 47->90|2co5B|3e-06|18.2|44/94| HM:PFM:NREP 2 HM:PFM:REP 43->74|PF01047|6.4e-10|46.9|32/59|MarR| HM:PFM:REP 61->89|PF11313|0.00095|31.0|29/85|DUF3116| RP:SCP:NREP 1 RP:SCP:REP 47->90|2co5A1|5e-07|18.2|44/89|a.4.5.48| HM:SCP:REP 6->90|2fbkA1|7.8e-10|43.5|85/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 95.7 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHTTcEEEEccTTccEEEEcHHHHH#### DISOP:02AL 90-94| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHcEEEcccccEEEEEEcHHHcccccc //